Ensifer aridi: ACEP9W_04525 Help Entry ACEP9W_04525      CDS       T10792                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism eaw  Ensifer aridi Pathway eaw00790   Folate biosynthesis eaw01100   Metabolic pathways eaw01240   Biosynthesis of cofactors Module eaw_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:eaw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACEP9W_04525 (folB) Enzymes [BR:eaw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ACEP9W_04525 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ACEP9W_04525 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ACEP9W_04525 (folB) SSDB OrthologParalogGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  XFE86946 UniProt:  A0ACH2TAB0 LinkDB All DBs Position 902016..902387 Genome browser AA seq 123 aa AA seqDB search MTATYTITLKNCAFFARHGVLDEEEFLGQRFFVDAELEVEQGTALVEDCIDDTVHYGIAF AEIERIVTGRRRYLIEALALEVAKTLCARFRQIRRAKVSIRKPNAPVPGVLDYVEVTVEH VAE NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgactgcgacctacacgatcacccttaagaactgcgcgttctttgcccgccacggcgtg ctcgacgaggaagagttcctcgggcagcgattcttcgtggatgcggagctcgaagtggag cagggcaccgcgctggtcgaggattgcatcgacgataccgtgcattacggtatcgctttc gccgagatcgagaggatcgttaccgggcgccggcgatatctgatcgaggcactggcgctt gaggtcgccaagacgctttgcgcgcgcttccgtcagatccgtcgggcgaaggtctcgata cgcaaaccgaacgcacccgttcccggggtgttggattacgtggaagtcacggtcgagcat gttgccgaataa

DBGET integrated database retrieval system