Enterobacteriaceae bacterium FGI 57: D782_0631 Help Entry D782_0631         CDS       T02431                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ebf  Enterobacteriaceae bacterium FGI 57 Pathway ebf00790   Folate biosynthesis ebf01100   Metabolic pathways ebf01240   Biosynthesis of cofactors Module ebf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ebf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     D782_0631 Enzymes [BR:ebf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      D782_0631  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      D782_0631  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      D782_0631 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGB76686 UniProt:  L0M1V2 LinkDB All DBs Position 643384..643752 Genome browser AA seq 122 aa AA seqDB search MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMGWDNRRAASSDDVKYCLSYADISEAV IEHVEGSRFALVERVAEEVAELLMTRFNSPWVRIKVSKPGAVARAANVGVIIERGQNLKQ TI NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggatattgtatttatagagcaactttcggtaatcaccactatcggtgtttacgactgg gaacagactatcgagcagaaactggtgttcgatatcgaaatgggatgggacaaccggcgg gcggcatccagcgacgacgtcaagtattgtctgagctatgccgatattagtgaagcggtg attgaacatgtcgaaggtagccgctttgcgctggttgaacgcgtggcggaagaggtggcc gaactgctcatgacgcgctttaactccccatgggtgcgtatcaaagtgagcaaacccggc gcggtcgccagggcggcgaacgtgggcgttatcatcgagcgtggccaaaatctgaaacaa actatttaa

DBGET integrated database retrieval system