Erwinia billingiae: EbC_06880 Help Entry EbC_06880         CDS       T01270                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ebi  Erwinia billingiae Pathway ebi00670   One carbon pool by folate ebi00790   Folate biosynthesis ebi01100   Metabolic pathways ebi01240   Biosynthesis of cofactors ebi04981   Folate transport and metabolism Module ebi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ebi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EbC_06880 (folA)    00670 One carbon pool by folate     EbC_06880 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     EbC_06880 (folA) Enzymes [BR:ebi01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      EbC_06880 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CAX58219 UniProt:  D8MN12 LinkDB All DBs Position 825897..826379 Genome browser AA seq 160 aa AA seqDB search MMISLIAAMAADRVIGMDNAMPWHLPADLAWFKRQTLDKPVIMGRRTWESIGRPLPGRLN IVISSQPGDAEGVSWVTSIDEALQAAGEVDEVMVIGGGRIYEQLLPRADRLYLTHIDAEV VGDTTFPDFEPEEWQSTFSEFHDADEKNSHSFCFEILQRR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgatgataagcctgattgcggccatggcggccgaccgcgttattggaatggataatgcc atgccgtggcacctgccagccgatttggcctggtttaaacgccagaccctggataagccg gtgatcatgggccgccgcacctgggagtccatcggacgcccgctgccaggcagactgaac attgtgatcagcagccagccgggcgatgcggaaggcgtcagctgggtgacctctatcgac gaggcgctgcaggcagccggagaagtggacgaagtgatggtcatcggtggcggtcgcatc tatgaacagctgttgccgcgtgccgatcgtctgtatctgacgcacattgatgcggaagtg gtgggcgacaccactttcccggatttcgaaccggaagagtggcagtcgaccttcagtgaa ttccacgatgcggatgagaagaacagccacagtttctgcttcgaaattctgcaacgtcgt taa

DBGET integrated database retrieval system