Erigeron canadensis (horseweed): 122588803 Help Entry 122588803         CDS       T07610                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ecad  Erigeron canadensis (horseweed) Pathway ecad03420   Nucleotide excision repair ecad04120   Ubiquitin mediated proteolysis ecad04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ecad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122588803    04120 Ubiquitin mediated proteolysis     122588803   09124 Replication and repair    03420 Nucleotide excision repair     122588803  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ecad04121]     122588803    03400 DNA repair and recombination proteins [BR:ecad03400]     122588803 Enzymes [BR:ecad01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122588803 Ubiquitin system [BR:ecad04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122588803   Multi subunit type E3    SCF complex     Ring finger protein      122588803    Cul2 complex      122588803    Cul3 complex      122588803    Cul4 complex      122588803    Cul7 complex      122588803    Cul8 complex      122588803    Cul9 complex      122588803 DNA repair and recombination proteins [BR:ecad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122588803     TCR (transcription coupled repair) factors      Cul4-CSA complex       122588803 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 zf-Nse PHD_NSD Motif Other DBs NCBI-GeneID:  122588803 NCBI-ProteinID:  XP_043616945 LinkDB All DBs Position 2:4142371..4147153 Genome browser AA seq 113 aa AA seqDB search MDTAGNEGSTSVKKNHNNNDKHFEIKKWNAISLWGWEIDNVERCAICRNHIVAESCIECQ ANQGTSISSGDKCVVAWGACNHVFHFHCISNWLKTRQVCPLDNTEWEFQKYGQ NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacacggctggcaacgaaggatccacttccgtaaagaaaaatcataataataatgac aagcatttcgagatcaaaaaatggaacgctatttctctatggggatgggagatagacaac gtggagagatgcgcaatttgtaggaaccatatcgtggcggagtcatgtattgaatgtcag gctaaccaaggcacttccatttccagcggtgacaagtgcgtagttgcttggggggcctgc aatcatgtgtttcattttcattgtattagcaactggctcaaaacccgtcaagtctgtcca ttagataacactgaatgggaattccagaagtatggtcagtag

DBGET integrated database retrieval system