Equus caballus (horse): 100051632 Help Entry 100051632         CDS       T01058                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism ecb  Equus caballus (horse) Pathway ecb01522   Endocrine resistance ecb04010   MAPK signaling pathway ecb04024   cAMP signaling pathway ecb04210   Apoptosis ecb04380   Osteoclast differentiation ecb04620   Toll-like receptor signaling pathway ecb04657   IL-17 signaling pathway ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04668   TNF signaling pathway ecb04713   Circadian entrainment ecb04725   Cholinergic synapse ecb04728   Dopaminergic synapse ecb04915   Estrogen signaling pathway ecb04917   Prolactin signaling pathway ecb04921   Oxytocin signaling pathway ecb04926   Relaxin signaling pathway ecb04928   Parathyroid hormone synthesis, secretion and action ecb04932   Non-alcoholic fatty liver disease ecb04935   Growth hormone synthesis, secretion and action ecb05031   Amphetamine addiction ecb05132   Salmonella infection ecb05133   Pertussis ecb05135   Yersinia infection ecb05140   Leishmaniasis ecb05142   Chagas disease ecb05161   Hepatitis B ecb05162   Measles ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05200   Pathways in cancer ecb05207   Chemical carcinogenesis - receptor activation ecb05208   Chemical carcinogenesis - reactive oxygen species ecb05210   Colorectal cancer ecb05224   Breast cancer ecb05231   Choline metabolism in cancer ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05323   Rheumatoid arthritis ecb05417   Lipid and atherosclerosis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100051632 (FOS)    04668 TNF signaling pathway     100051632 (FOS)    04024 cAMP signaling pathway     100051632 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100051632 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100051632 (FOS)    04660 T cell receptor signaling pathway     100051632 (FOS)    04658 Th1 and Th2 cell differentiation     100051632 (FOS)    04659 Th17 cell differentiation     100051632 (FOS)    04657 IL-17 signaling pathway     100051632 (FOS)    04662 B cell receptor signaling pathway     100051632 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     100051632 (FOS)    04917 Prolactin signaling pathway     100051632 (FOS)    04921 Oxytocin signaling pathway     100051632 (FOS)    04926 Relaxin signaling pathway     100051632 (FOS)    04935 Growth hormone synthesis, secretion and action     100051632 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     100051632 (FOS)   09156 Nervous system    04725 Cholinergic synapse     100051632 (FOS)    04728 Dopaminergic synapse     100051632 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     100051632 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     100051632 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100051632 (FOS)    05207 Chemical carcinogenesis - receptor activation     100051632 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     100051632 (FOS)    05231 Choline metabolism in cancer     100051632 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100051632 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     100051632 (FOS)    05224 Breast cancer     100051632 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100051632 (FOS)    05170 Human immunodeficiency virus 1 infection     100051632 (FOS)    05161 Hepatitis B     100051632 (FOS)    05171 Coronavirus disease - COVID-19     100051632 (FOS)    05162 Measles     100051632 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     100051632 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100051632 (FOS)    05135 Yersinia infection     100051632 (FOS)    05133 Pertussis     100051632 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100051632 (FOS)    05142 Chagas disease     100051632 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     100051632 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     100051632 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100051632 (FOS)    05418 Fluid shear stress and atherosclerosis     100051632 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100051632 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100051632 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ecb03000]     100051632 (FOS)    04131 Membrane trafficking [BR:ecb04131]     100051632 (FOS) Transcription factors [BR:ecb03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100051632 (FOS) Membrane trafficking [BR:ecb04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100051632 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  100051632 NCBI-ProteinID:  XP_001492022 Ensembl:  ENSECAG00000014260 VGNC:  18095 UniProt:  F7AJ44 LinkDB All DBs Position 24:20589698..20593126 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRTGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPLASELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccactcgccggccgactccttctccagtatg ggctctccggtcaatgcgcaggactactgcacggatttggccgtctccagtgccaacttc atcccaacggtaactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctcggtagccccatcccagaccagagctcctcacccctatggagtccccacc ccctcggctggggcttactccaggacgggagtcgtgaagaccatgacaggaggcagagct cagagcattggcagaaggggcaaggtggaacagttgtctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaaccttctgaaggagaaggaaaaactagagttcatcctggcagctcac cggcctgcctgcaagatccccgatgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc ctgcccctccttaacgatcctgagcccaagccctcagtggagcctgtcaagagcatcagc agcatggagctgaaggctgagccctttgatgacttcatgttcccagcatcgtcccggccc agtggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggatggggcccctggcctcagagctg gagcccctgtgcactccggtggtcacctgtactcccagctgcaccacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system