Equus caballus (horse): 100052025 Help Entry 100052025         CDS       T01058                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism ecb  Equus caballus (horse) Pathway ecb04010   MAPK signaling pathway ecb04014   Ras signaling pathway ecb04015   Rap1 signaling pathway ecb04024   cAMP signaling pathway ecb04062   Chemokine signaling pathway ecb04510   Focal adhesion ecb04520   Adherens junction ecb04611   Platelet activation ecb04670   Leukocyte transendothelial migration ecb04720   Long-term potentiation ecb04722   Neurotrophin signaling pathway ecb04934   Cushing syndrome ecb04972   Pancreatic secretion ecb05211   Renal cell carcinoma ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100052025 (RAP1B)    04014 Ras signaling pathway     100052025 (RAP1B)    04015 Rap1 signaling pathway     100052025 (RAP1B)    04024 cAMP signaling pathway     100052025 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100052025 (RAP1B)    04520 Adherens junction     100052025 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100052025 (RAP1B)    04670 Leukocyte transendothelial migration     100052025 (RAP1B)    04062 Chemokine signaling pathway     100052025 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     100052025 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     100052025 (RAP1B)    04722 Neurotrophin signaling pathway     100052025 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     100052025 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100052025 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100052025 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100052025 (RAP1B)    04031 GTP-binding proteins [BR:ecb04031]     100052025 (RAP1B) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100052025 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    100052025 (RAP1B)   Exosomal proteins of colorectal cancer cells    100052025 (RAP1B) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     100052025 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  100052025 NCBI-ProteinID:  NP_001240767 Ensembl:  ENSECAG00000004651 UniProt:  A0A5F5PF18 LinkDB All DBs Position 6:84904609..84913663 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CRLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctggtcgttctcggctcgggaggcgtcggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacaatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcggga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttgcaagatctgagagagcagatt cttcgagttaaagacactgacgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgaggcaaattaacagaaaaactcccgtgcctgggaaggctcgcaaaaagtcgtcg tgtcggctgctttaa

DBGET integrated database retrieval system