Equus caballus (horse): 100052545 Help Entry 100052545         CDS       T01058                                  Symbol IFNB1 Name (RefSeq) interferon beta precursor   KO K05415   interferon beta Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04151   PI3K-Akt signaling pathway ecb04217   Necroptosis ecb04380   Osteoclast differentiation ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04622   RIG-I-like receptor signaling pathway ecb04623   Cytosolic DNA-sensing pathway ecb04630   JAK-STAT signaling pathway ecb04650   Natural killer cell mediated cytotoxicity ecb04668   TNF signaling pathway ecb04936   Alcoholic liver disease ecb05135   Yersinia infection ecb05142   Chagas disease ecb05152   Tuberculosis ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05164   Influenza A ecb05165   Human papillomavirus infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100052545 (IFNB1)    04668 TNF signaling pathway     100052545 (IFNB1)    04151 PI3K-Akt signaling pathway     100052545 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100052545 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100052545 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100052545 (IFNB1)    04621 NOD-like receptor signaling pathway     100052545 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100052545 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100052545 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100052545 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100052545 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100052545 (IFNB1)    05161 Hepatitis B     100052545 (IFNB1)    05160 Hepatitis C     100052545 (IFNB1)    05171 Coronavirus disease - COVID-19     100052545 (IFNB1)    05164 Influenza A     100052545 (IFNB1)    05162 Measles     100052545 (IFNB1)    05168 Herpes simplex virus 1 infection     100052545 (IFNB1)    05163 Human cytomegalovirus infection     100052545 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100052545 (IFNB1)    05169 Epstein-Barr virus infection     100052545 (IFNB1)    05165 Human papillomavirus infection     100052545 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100052545 (IFNB1)    05152 Tuberculosis     100052545 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100052545 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100052545 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100052545 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100052545 (IFNB1) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Interferons    100052545 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon KAR9 Motif Other DBs NCBI-GeneID:  100052545 NCBI-ProteinID:  NP_001092910 UniProt:  P05012 A0A7R8C3S1 LinkDB All DBs Position 23:complement(39688443..39689003) Genome browser AA seq 186 aa AA seqDB search MTYRWILPMALLLCFSTTALSVNYDLLRSQLRSSNSACLMLLRQLNGAPQRCPEDTMNFQ VPEEIEQAQQFQKEDAALVIYEMLQHTWRIFRRNFASTGWNETIVKNLLVEVHLQMDRLE TNLEEIMEEESSTWGNTTILRLKKYYGRISQYLKAKKYSHCAWTVVQAEMLRNLAFLNGL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctacaggtggatcctcccaatggccctcctgctgtgtttctccaccacggctctt tctgtgaactatgacttgcttcggtcccaactaagaagcagcaattcagcatgtctgatg ctcctgcggcagttgaatggagcccctcaacgttgccccgaggacacaatgaacttccag gtccctgaggagattgagcaagcacagcagttccagaaggaggatgctgcattggtcatc tatgagatgctccagcacacctggcgtattttcagaagaaatttcgctagcactggctgg aatgagaccatcgttaagaacctccttgtggaagtccatctgcagatggaccgtctggag acaaacctggaggaaataatggaggaggaaagctccacctggggaaacacaaccattctg cgcctgaagaaatactacggaaggatctcgcagtacctgaaggccaagaagtacagccac tgtgcctggacagtggtccaagcggaaatgctcaggaacttggccttccttaacggactc acagattacctccaaaactga

DBGET integrated database retrieval system