Equus caballus (horse): 100058432 Help Entry 100058432         CDS       T01058                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism ecb  Equus caballus (horse) Pathway ecb01523   Antifolate resistance ecb04010   MAPK signaling pathway ecb04014   Ras signaling pathway ecb04062   Chemokine signaling pathway ecb04064   NF-kappa B signaling pathway ecb04151   PI3K-Akt signaling pathway ecb04210   Apoptosis ecb04380   Osteoclast differentiation ecb04519   Cadherin signaling ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04622   RIG-I-like receptor signaling pathway ecb04623   Cytosolic DNA-sensing pathway ecb04625   C-type lectin receptor signaling pathway ecb04657   IL-17 signaling pathway ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04668   TNF signaling pathway ecb04920   Adipocytokine signaling pathway ecb04936   Alcoholic liver disease ecb05010   Alzheimer disease ecb05132   Salmonella infection ecb05135   Yersinia infection ecb05142   Chagas disease ecb05145   Toxoplasmosis ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05164   Influenza A ecb05165   Human papillomavirus infection ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease ecb05200   Pathways in cancer ecb05203   Viral carcinogenesis ecb05208   Chemical carcinogenesis - reactive oxygen species ecb05212   Pancreatic cancer ecb05215   Prostate cancer ecb05220   Chronic myeloid leukemia ecb05221   Acute myeloid leukemia ecb05222   Small cell lung cancer ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05340   Primary immunodeficiency ecb05417   Lipid and atherosclerosis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100058432 (IKBKG)    04014 Ras signaling pathway     100058432 (IKBKG)    04064 NF-kappa B signaling pathway     100058432 (IKBKG)    04668 TNF signaling pathway     100058432 (IKBKG)    04151 PI3K-Akt signaling pathway     100058432 (IKBKG)   09133 Signaling molecules and interaction    04519 Cadherin signaling     100058432 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100058432 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100058432 (IKBKG)    04621 NOD-like receptor signaling pathway     100058432 (IKBKG)    04622 RIG-I-like receptor signaling pathway     100058432 (IKBKG)    04623 Cytosolic DNA-sensing pathway     100058432 (IKBKG)    04625 C-type lectin receptor signaling pathway     100058432 (IKBKG)    04660 T cell receptor signaling pathway     100058432 (IKBKG)    04658 Th1 and Th2 cell differentiation     100058432 (IKBKG)    04659 Th17 cell differentiation     100058432 (IKBKG)    04657 IL-17 signaling pathway     100058432 (IKBKG)    04662 B cell receptor signaling pathway     100058432 (IKBKG)    04062 Chemokine signaling pathway     100058432 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100058432 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     100058432 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100058432 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     100058432 (IKBKG)    05203 Viral carcinogenesis     100058432 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100058432 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     100058432 (IKBKG)    05221 Acute myeloid leukemia     100058432 (IKBKG)    05220 Chronic myeloid leukemia     100058432 (IKBKG)    05215 Prostate cancer     100058432 (IKBKG)    05222 Small cell lung cancer     100058432 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100058432 (IKBKG)    05170 Human immunodeficiency virus 1 infection     100058432 (IKBKG)    05161 Hepatitis B     100058432 (IKBKG)    05160 Hepatitis C     100058432 (IKBKG)    05171 Coronavirus disease     100058432 (IKBKG)    05164 Influenza A     100058432 (IKBKG)    05162 Measles     100058432 (IKBKG)    05168 Herpes simplex virus 1 infection     100058432 (IKBKG)    05163 Human cytomegalovirus infection     100058432 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     100058432 (IKBKG)    05169 Epstein-Barr virus infection     100058432 (IKBKG)    05165 Human papillomavirus infection     100058432 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     100058432 (IKBKG)    05135 Yersinia infection     100058432 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100058432 (IKBKG)    05142 Chagas disease     100058432 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     100058432 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     100058432 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100058432 (IKBKG)    05418 Fluid shear stress and atherosclerosis     100058432 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100058432 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100058432 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ecb01001]     100058432 (IKBKG) Protein kinases [BR:ecb01001]  Serine/threonine kinases: Other   IKK family [OT]    100058432 (IKBKG) SSDB OrthologParalogGFIT Motif Pfam:  CC2-LZ NEMO zf_C2H2_10 LLC1 Filament CCDC39 Nairovirus_NSm Motif Other DBs NCBI-GeneID:  100058432 NCBI-ProteinID:  NP_001271462 Ensembl:  ENSECAG00000020595 VGNC:  18986 UniProt:  A0A9R1SSY0 LinkDB All DBs Position X:126889355..126915317 Genome browser AA seq 419 aa AA seqDB search MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQGTPETFQRCLEENQE LRDAIRQSNQMLRERCEELQHFQSSQREEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ ALKEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ ARQLESEREALQQQHNVQVDQLRMQTQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE YDNHIKSSMVSSERNRGMQLEDLKQQLQQAEEALVAKQEAIDKLKEEAEQHKIVMETVPV LKAQADIYKADFQAERQAREKLAEKKECLQEQLEQLQREYSRLKASCQESARIEDMRKRH VEVSQPPLPPTPAHHSIHSALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt atgagcaggcccccctggaagagtcagctgtgtgagatggtacagcctagtggcggcccg gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccggccatgctccac ctgccttcggagcagggaactcctgagaccttccagcgttgtctggaggagaatcaagag ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag catttccagagcagccagagggaggagaaggagttcctcatgcagaaattccaggaggcc agaaaactggtggagagactgagcctggagaagcttgacctgaggaggcagcgggaacag gccctgaaggaggtggaacacctgaagagatgccagcagcagatggccgaggataaggcc tcagtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg gaggccgccactaaggagcggcaggctctggagggcagggcccgggcggccagtgagcag gcccggcagctggagagtgagcgggaggcgctgcagcagcagcacaacgtgcaggtggac cagctgcgcatgcagacccagagcatggaggctgccctgcgcatggagcgccaggctgcc tcggaggagaagcggaagctggcccagctacaggtagcctatcaccagctcttccaagag tatgacaaccacatcaagagcagcatggtgagcagtgagcggaaccgaggaatgcagctg gaagatcttaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagcg attgacaagctcaaggaagaggccgagcagcataagattgtgatggagaccgttccggtg ctgaaggcccaggcggatatctacaaggcggacttccaggcggaaaggcaggcccgggag aagctggctgagaaaaaggagtgtctgcaggagcagctggagcagctgcagagggagtac agccggttgaaggccagctgtcaggagtcagccaggatcgaagatatgaggaagcggcat gtagaggtctcccagccccccttaccccccaccccagctcaccactccattcactcggcc ctgcccagccagaggagaagtccccccgaggagccacccgacttctgttgccccaagtgc cagtaccaggctcctgacatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system