Equus caballus (horse): 100062044 Help Entry 100062044         CDS       T01058                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism ecb  Equus caballus (horse) Pathway ecb01522   Endocrine resistance ecb01524   Platinum drug resistance ecb04010   MAPK signaling pathway ecb04071   Sphingolipid signaling pathway ecb04110   Cell cycle ecb04115   p53 signaling pathway ecb04137   Mitophagy - animal ecb04151   PI3K-Akt signaling pathway ecb04210   Apoptosis ecb04211   Longevity regulating pathway ecb04216   Ferroptosis ecb04218   Cellular senescence ecb04310   Wnt signaling pathway ecb04722   Neurotrophin signaling pathway ecb04919   Thyroid hormone signaling pathway ecb05012   Parkinson disease ecb05014   Amyotrophic lateral sclerosis ecb05016   Huntington disease ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05165   Human papillomavirus infection ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05200   Pathways in cancer ecb05202   Transcriptional misregulation in cancer ecb05203   Viral carcinogenesis ecb05205   Proteoglycans in cancer ecb05206   MicroRNAs in cancer ecb05210   Colorectal cancer ecb05212   Pancreatic cancer ecb05213   Endometrial cancer ecb05214   Glioma ecb05215   Prostate cancer ecb05216   Thyroid cancer ecb05217   Basal cell carcinoma ecb05218   Melanoma ecb05219   Bladder cancer ecb05220   Chronic myeloid leukemia ecb05222   Small cell lung cancer ecb05223   Non-small cell lung cancer ecb05224   Breast cancer ecb05225   Hepatocellular carcinoma ecb05226   Gastric cancer ecb05230   Central carbon metabolism in cancer ecb05417   Lipid and atherosclerosis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100062044 (TP53)    04310 Wnt signaling pathway     100062044 (TP53)    04071 Sphingolipid signaling pathway     100062044 (TP53)    04151 PI3K-Akt signaling pathway     100062044 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100062044 (TP53)   09143 Cell growth and death    04110 Cell cycle     100062044 (TP53)    04210 Apoptosis     100062044 (TP53)    04216 Ferroptosis     100062044 (TP53)    04115 p53 signaling pathway     100062044 (TP53)    04218 Cellular senescence     100062044 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100062044 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100062044 (TP53)   09149 Aging    04211 Longevity regulating pathway     100062044 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100062044 (TP53)    05202 Transcriptional misregulation in cancer     100062044 (TP53)    05206 MicroRNAs in cancer     100062044 (TP53)    05205 Proteoglycans in cancer     100062044 (TP53)    05203 Viral carcinogenesis     100062044 (TP53)    05230 Central carbon metabolism in cancer     100062044 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     100062044 (TP53)    05212 Pancreatic cancer     100062044 (TP53)    05225 Hepatocellular carcinoma     100062044 (TP53)    05226 Gastric cancer     100062044 (TP53)    05214 Glioma     100062044 (TP53)    05216 Thyroid cancer     100062044 (TP53)    05220 Chronic myeloid leukemia     100062044 (TP53)    05217 Basal cell carcinoma     100062044 (TP53)    05218 Melanoma     100062044 (TP53)    05219 Bladder cancer     100062044 (TP53)    05215 Prostate cancer     100062044 (TP53)    05213 Endometrial cancer     100062044 (TP53)    05224 Breast cancer     100062044 (TP53)    05222 Small cell lung cancer     100062044 (TP53)    05223 Non-small cell lung cancer     100062044 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100062044 (TP53)    05161 Hepatitis B     100062044 (TP53)    05160 Hepatitis C     100062044 (TP53)    05162 Measles     100062044 (TP53)    05168 Herpes simplex virus 1 infection     100062044 (TP53)    05163 Human cytomegalovirus infection     100062044 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     100062044 (TP53)    05169 Epstein-Barr virus infection     100062044 (TP53)    05165 Human papillomavirus infection     100062044 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     100062044 (TP53)    05014 Amyotrophic lateral sclerosis     100062044 (TP53)    05016 Huntington disease     100062044 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100062044 (TP53)    05418 Fluid shear stress and atherosclerosis     100062044 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100062044 (TP53)    01522 Endocrine resistance     100062044 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ecb03000]     100062044 (TP53)    03036 Chromosome and associated proteins [BR:ecb03036]     100062044 (TP53)    03400 DNA repair and recombination proteins [BR:ecb03400]     100062044 (TP53) Transcription factors [BR:ecb03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100062044 (TP53) Chromosome and associated proteins [BR:ecb03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100062044 (TP53) DNA repair and recombination proteins [BR:ecb03400]  Eukaryotic type   Check point factors    Other check point factors     100062044 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  100062044 NCBI-ProteinID:  NP_001189334 UniProt:  E9NME8 LinkDB All DBs Position 11:complement(50952714..50966318) Genome browser AA seq 381 aa AA seqDB search MEETQTELGIEPPLSQETFSDLWKLLPENNVLSPDLSPAVNNLLLSPDVVNWLDEGPDEA PRMPAAPAPLAPAPATSWPLSSFVPSQKTYPGCYGFRLGFLNSGTAKSVTCTYSPTLNKL FCQLAKTCPVQLLVSSPPPPGTRVRAMAIYKKSEFMTEVVRRCPHHERCSDSSDGLAPPQ HLIRVEGNLRAEYLEDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPIL TIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKEEPCPEPPPRSTKRVLSSNT SSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEPGGSKAHSSHLKSK KGQSTSSHKKLIFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atggaggagacgcagacagaactcggcatcgagccccctctgagtcaggagacgttttca gatttgtggaagctacttcctgaaaacaatgttctgtcccctgacctgtccccagcagtg aataatctgctgctgtccccagatgttgtgaactggctggatgaaggcccagatgaagcc cccagaatgccagcagctcctgcaccactagcccctgcaccagccacctcctggcccctg tcatcctttgtcccttcccaaaagacctaccctggctgctatggtttccgtttagggttc ctgaattctgggacagccaagtctgttacttgcacgtactcccctaccctcaacaaactg ttttgccagctggcaaagacctgccccgtgcagctcctggtcagctcaccacccccaccc ggcacccgtgtccgggccatggccatctacaagaagtcagagttcatgacggaggtcgtg aggcgctgcccccaccatgaacgctgctctgacagtagcgatggtctggcccctcctcag catctcatccgggtggaagggaatctgcgtgctgagtatttggaagacagaaacactttt cgacatagcgtggtggtgccctacgagccacctgaggttggctctgactgtaccaccatc cactacaacttcatgtgtaacagctcctgcatgggcggcatgaaccggcggcccatcctc actatcatcaccctggaagactccagtggtaatctgctgggacggaacagctttgaggtg cgtgtttgtgcctgtcctgggagagaccggcgcacagaggaagaaaacttccgcaagaag gaggaaccttgccctgagccgcctcctaggagcactaagcgagtattgtccagtaacacc agctcctctcccccacaaaagaagaagccactggatggagaatatttcacccttcagatc cgtgggcgtgaacgttttgagatgttccgagagctgaatgaggccttggagctgaaagat gcccagactggaaaggagccagggggaagcaaggctcactccagccacctgaagtctaag aaggggcagtctacctcctcccataaaaagctgatattcaagagagaagggcctgactca gactga

DBGET integrated database retrieval system