Equus caballus (horse): 100629660 Help Entry 100629660         CDS       T01058                                  Symbol CD209 Name (RefSeq) CD209 antigen isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism ecb  Equus caballus (horse) Pathway ecb03260   Virion - Human immunodeficiency virus ecb03264   Virion - Flavivirus and Alphavirus ecb03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus ecb03273   Virion - Lassa virus and SFTS virus ecb04145   Phagosome ecb04625   C-type lectin receptor signaling pathway ecb05152   Tuberculosis ecb05162   Measles Brite KEGG Orthology (KO) [BR:ecb00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     100629660 (CD209)    03264 Virion - Flavivirus and Alphavirus     100629660 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     100629660 (CD209)    03273 Virion - Lassa virus and SFTS virus     100629660 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100629660 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100629660 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     100629660 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     100629660 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100629660 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:ecb04054]     100629660 (CD209)    04515 Cell adhesion molecules [BR:ecb04515]     100629660 (CD209)    04090 CD molecules [BR:ecb04090]     100629660 (CD209)    04091 Lectins [BR:ecb04091]     100629660 (CD209) Membrane trafficking [BR:ecb04131]  Endocytosis   Phagocytosis    C-lectin receptors     100629660 (CD209) Pattern recognition receptors [BR:ecb04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    100629660 (CD209) Cell adhesion molecules [BR:ecb04515]  Lectins   Selectins and C-type lectins    100629660 (CD209) CD molecules [BR:ecb04090]  Proteins   100629660 (CD209) Lectins [BR:ecb04091]  C-Type lectins   Asialoglycoprotein and DC receptors    100629660 (CD209) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  100629660 NCBI-ProteinID:  XP_005611561 Ensembl:  ENSECAG00000021212 UniProt:  A0A9L0SUC3 LinkDB All DBs Position 7:complement(5591802..5597380) Genome browser AA seq 238 aa AA seqDB search MDQRDPKEPMALDDEELMTSGNRLSYKDFGFQKSHGFKNFPGCRGQGRAPLVLLFLSLMV FAGLLVAILVQVSKVPRSQGLEPSKQEEIQQILTQLKAGIALLCHPCPWGWRSFQGNCYF FSNSQLNWHDSVTACEEVEAQLVVIESAEEQNFLQVQASRFNRLTWMGLSDLKHEGTWHW VDGSPLLPSFVKYWNEGEPNSSGEEDCAEFRGKGWNDSKCSLSKFWICKKPTTSCSSA NT seq 717 nt NT seq  +upstreamnt  +downstreamnt atggaccagcgtgaccccaaggaaccgatggcactggatgacgaagagctgatgaccagc gggaacagactttcctacaaagactttggattccaaaagagtcatggcttcaagaacttc ccagggtgtcgggggcagggccgggcccccctggtgctcctgttcctttccctcatggtc ttcgctgggctcctggtggccatccttgtccaagtctccaaggtccccaggtcccagggg ctggagccttcgaagcaggaggagatccagcaaatactgacccagctgaaggctggaatc gcccttctgtgccacccctgtccctggggctggcggtccttccaaggaaattgctacttc ttctccaactcgcaactcaactggcacgactccgtgactgcctgtgaggaagtggaggct caacttgtagtcattgaaagcgctgaggagcagaacttcctgcaggtccaggcttccagg tttaaccgcttgacctggatggggctctcagacctgaaacacgaaggcacgtggcactgg gtggacggttctcccctgttgcccagcttcgtgaagtattggaatgaaggagagcccaac agcagtggggaggaagactgcgcggagtttaggggcaaaggctggaacgactccaaatgc agcctcagcaaattctggatttgcaaaaagcccacaacctcgtgctccagtgcctaa

DBGET integrated database retrieval system