KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3941
Entry
E2348C_3941       CDS       T00796                                 
Symbol
tir
Name
(GenBank) translocated intimin receptor Tir
  KO
K12784  translocated intimin receptor
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Module
ecg_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_3941 (tir)
SSDB
Motif
Pfam: Tir_receptor_N Tir_receptor_C Tir_receptor_M DUF2490 POPLD
Other DBs
NCBI-ProteinID: CAS11489
UniProt: B7UM99
LinkDB
Position
complement(4113830..4115482)
AA seq 550 aa
MPIGNLGNNVNGNHLIPPAPPLPSQTDGAARGGTGHLISSTGALGSRSLFSPLRNSMADS
VDSRDIPGLPTNPSRLAAATSETCLLGGFEVLHDKGPLDILNTQIGPSAFRVEVQADGTH
AAIGEKNGLEVSVTLSPQEWSSLQSIDTEGKNRFVFTGGRGGSGHPMVTVASDIAEARTK
ILAKLDPDNHGGRQPKDVDTRSVGVGSASGIDDGVVSETHTSTTNSSVRSDPKFWVSVGA
IAAGLAGLAATGIAQALALTPEPDDPTTTDPDQAANAAESATKDQLTQEAFKNPENQKVN
IDANGNAIPSGELKDDIVEQIAQQAKEAGEVARQQAVESNAQAQQRYEDQHARRQEELQL
SSGIGYGLSSALIVAGGIGAGVTTALHRRNQPAEQTTTTTTHTVVQQQTGGNTPAQGGTD
ATRAEDASLNRRDSQGSVASTHWSDSSSEVVNPYAEVGGARNSLSAHQPEEHIYDEVAAD
PGYSVIQNFSGSGPVTGRLIGTPGQGIQSTYALLANSGGLRLGMGGLTSGGESAVSSVNA
APTPGPVRFV
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgcctattggtaaccttggtaataatgtaaatggcaatcatttaattccccctgcgccg
ccactaccttcacaaacagacggcgcggcacggggaggaactggtcatctaattagctct
acaggagcattaggatctcgttcattgttttctcccctgagaaattctatggctgattct
gtcgattccagagatattccaggacttcctacaaacccatcgaggcttgctgcagctaca
tctgagacatgcttgcttggaggatttgaagttctccatgataaggggccacttgatatt
ctcaatacgcaaattggaccctctgcatttcgtgttgaagtgcaggcagatggtactcat
gccgctattggagaaaaaaatggtttggaggttagcgttacattaagtcctcaagaatgg
agcagcttgcaatctattgatactgagggtaaaaacagatttgtttttaccgggggacgt
ggcggtagtgggcatccgatggtcactgtcgcatcagatatcgcggaagctcgtacgaaa
atactggccaaattagacccagacaatcatggaggacgtcaacccaaggacgttgatacg
cgttctgttggtgttggcagcgcttcgggaatagatgatggcgttgttagcgaaacccat
acttcaacaacaaattccagcgttcgctcagatcctaaattctgggtttctgtcggcgca
attgctgctggtttagcgggactggcggcaactggtattgcacaggcgttggctttgaca
ccggaaccggatgatcctacaaccaccgatcctgatcaggccgcaaatgctgcagaaagt
gcaacaaaagatcagttaacgcaagaagcattcaagaaccctgagaaccagaaagttaac
atcgatgcgaacggaaatgctattccgtctggggaattaaaagatgatattgttgagcaa
atagcacaacaagctaaagaggctggtgaggtggccagacagcaggctgttgaaagcaat
gcacaggcgcagcagcgatatgaggatcagcatgccagacgtcaggaggaattacagctt
tcatcgggtattggttacggcctcagcagtgcattgattgttgctgggggaattggtgct
ggtgtaacgactgcgctccatagacgaaatcagccggcagaacagacaactactacaaca
acacatacggtagtgcagcaacagaccggagggaataccccagcacaaggtggcactgat
gccacaagagcagaagacgcttctctgaatagacgtgattcgcaggggagtgttgcatcg
acacactggtcagattcctctagcgaagtggttaatccatatgctgaagttgggggggct
cggaatagtctatcggctcatcagccagaagagcatatttatgatgaggtcgctgcagat
cctggttatagcgttattcagaatttttcagggagcggcccagttaccggaaggttaata
ggaactccagggcaaggtatccaaagtacttatgcgcttctggcaaacagcggcggattg
cgtttaggtatgggaggattaacgagtggtggcgagagcgcagtaagttctgtaaatgcc
gcaccaacgccgggaccagtacgtttcgtttaa

DBGET integrated database retrieval system