KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2757
Entry
ECRM13516_2757    CDS       T03011                                 
Symbol
nleA
Name
(GenBank) T3SS secreted effector protein NleA
  KO
K16041  non-LEE-encoded effector NleA
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2757 (nleA)
SSDB
Motif
Pfam: CopC
Other DBs
NCBI-ProteinID: AHG15413
LinkDB
Position
2711209..2712444
AA seq 411 aa
MNIQPIVQSGITTQNNQHHHTEQTPPTQIPQSELPNGCETGFVVYIPEDMQRHAPECGET
TALLGLIRDKGLLSGLDAYLAPHLEEGSAGKKALDMFGLFNVTQMALEIPSSVPGVSGKY
GVQMNIVKPDIHPTTGNYVLQLFPAHDEIGINYRDLPGPLKNVLSSDAVPWFGLTAQVVR
NHGVELPIVKTENGWKLVGETPLTPDGPKANYTEEWVIRPAEADLKYGTSPFQATLGLEF
GAHFKWDLDNPRTKYAVLTNAAANAVGAAGGFAVSRLTGVAPMLAPHIGSMAGQAVGHAV
QCNTQGLKPDAILWWAGSTLGLADLNKAETGEARFTDYPRIWWHAREGAIFPNKEDIARA
TGADIRAMEEGVPVDHRHPHPEDVVIDIESSPHNNPSNYVDTVDIIRETRV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaacattcaaccgatcgtacaatccggaattaccacacaaaacaatcaacatcatcac
acagaacaaacgcccccaacacaaataccgcaatccgaattacctaatggatgcgaaacg
ggatttgttgtttatatcccagaggatatgcagcgacatgcaccggaatgcggtgaaaca
acagctctgttgggtttaataagagataaaggtctgctctcagggttagacgcatatctt
gcgcctcatcttgaagaaggctctgcaggaaaaaaagcattggatatgtttggtttattc
aatgttactcagatggcattagaaatacccagttccgtccctggtgtttctggtaaatat
ggtgttcagatgaacatagtaaaaccagatatacatcccacaaccgggaactatgtctta
cagttatttcctgcacatgatgaaataggaattaactacagagaccttccaggaccacta
aaaaatgtattgtcatcggatgcagtgccttggtttggattaacggctcaggttgttcgt
aaccatggtgtagagcttccaattgtaaaaaccgaaaatgggtggaagcttgtcggggaa
acccctcttactcctgatggacctaaagccaattatacggaagagtgggttatcagacca
gcggaagctgatttaaaatatggaacatccccattccaggcgactctgggactggagttt
ggcgcacattttaagtgggatttagataatcctcgaaccaaatatgccgttcttaccaat
gcggcagcgaatgcggttggcgcagcagggggatttgcggtatccagactcaccggagta
gccccaatgttagcccctcatattggttcaatggccggacaggctgtggggcatgctgta
caatgcaacacccaaggattaaagccagacgctattttatggtgggctggttctactctg
gggctggcagatttaaacaaagccgagaccggagaagccagattcactgactatcctcgt
atatggtggcatgcaagagaaggagccatcttccccaataaagaagatattgcccgtgca
acaggggctgatatacgtgcgatggaagaaggtgtccctgttgatcatcgacatccacat
cctgaagatgtggtcatcgatatcgaaagctctccacataataatccatcaaattatgtt
gatacggttgatataatccgagaaacaagagtctaa

DBGET integrated database retrieval system