KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4478
Entry
ECRM13516_4478    CDS       T03011                                 
Symbol
tir
Name
(GenBank) translocated intimin receptor Tir
  KO
K12784  translocated intimin receptor
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_4478 (tir)
SSDB
Motif
Pfam: Tir_receptor_N Tir_receptor_C Tir_receptor_M
Other DBs
NCBI-ProteinID: AHG17093
LinkDB
Position
complement(4433983..4435665)
AA seq 560 aa
MPIGNLGHNPNVNNSIPPAPPLPSQTDGAGGRGQLINSTGPLGSRALFTPVRNSMADSGD
NRASDVPGLPVNPMRLAASEITLNDGFEVLHDHGPLDTLNRQIGSSVFRVETQEDGKHIA
VGQRNGVETSVVLSDQEYARLQSIDPEGKDKFVFTGGRGGAGHAMVTVASDITEARQRIL
ELLEPKGTGESKGAGESKGVGELRESNSGAENTTETQTSTSTSTSTSSLRSDPKLWLALG
TVATGLIGLAATGIVQALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKV
NIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELK
VSSGAGYGLSGALILGGGIGVAVTAALHRKNQPVEQTTTTTTTTTSARTVENKPANNTPA
QGNVDTPGSEDTMESRRSSMASTSSTFFDTSSIGTVQNPYADVKTSLHDSQVPTSNSNTS
VQNMGNTDSVVYSTIQHPPRDTTDNGARLLGNPSAGIQSTYARLALSGGLRHDMGGLTGG
SNSAVNTSNNPPAPGSHRFV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcctattggtaatcttggtcataatcccaatgtgaataattcaattcctcctgcacct
ccattaccttcacaaaccgacggtgcaggggggcgtggtcagctcattaactctacgggg
ccgttgggatctcgtgcgctatttacgcctgtaaggaattctatggctgattctggcgac
aatcgtgccagtgatgttcctggacttcctgtaaatccgatgcgcctggcggcgtctgag
ataacactgaatgatggatttgaagttcttcatgatcatggtccgctcgatactcttaac
aggcagattggctcttcggtatttcgagttgaaactcaggaagatggtaaacatattgct
gtcggtcagaggaatggtgttgagacctctgttgttttaagtgatcaagagtacgctcgc
ttgcagtccattgatcctgaaggtaaagacaaatttgtatttactggaggccgtggtggt
gctgggcatgctatggtcaccgttgcttcagatatcacggaagcccgccaaaggatactg
gagctgttagagcccaaagggaccggggagtccaaaggtgctggggagtcaaaaggcgtt
ggggagttgagggagtcaaatagcggtgcggaaaacaccacagaaactcagacctcaacc
tcaacttcaacctcaacttccagccttcgttcagatcctaaactttggttggcgttgggg
actgttgctacaggtctgatagggttggcggcgacgggtattgtacaggcgcttgcattg
acgccggagccggatagcccaaccacgaccgaccctgatgcagctgcaagtgcaactgaa
actgcgacaagagatcagttaacgaaagaagcgttccagaacccagataatcaaaaagtt
aatatcgatgagctcggaaatgcgattccgtcaggggtattgaaagatgatgttgttgcg
aatatagaagagcaggctaaagcagcaggcgaagaggccaaacagcaagccattgaaaat
aatgctcaggcgcaaaaaaaatatgatgaacaacaagctaaacgccaggaggagctgaaa
gtttcatcgggggctggctacggtcttagtggcgcattgattcttggtgggggaattggt
gttgccgtcaccgctgcgcttcatcgaaaaaatcagccggtagaacaaacaacaacaact
actactacaactacaagcgcacgtacggtagagaataagcctgcaaataatacacctgca
cagggcaatgtagatacccctgggtcagaagataccatggagagcagacgtagctcgatg
gctagcacctcgtcgactttctttgacacttccagcatagggaccgtgcagaatccgtat
gctgatgttaaaacatcgctgcatgattcgcaggtgccgacttctaattctaatacgtct
gttcagaatatggggaatacagattctgttgtatatagcaccattcaacatcctccccgg
gatactactgataacggcgcacggttattaggaaatccaagtgcggggattcaaagcact
tatgcgcgtctggcgctaagtggtggattacgccatgacatgggaggattaacggggggg
agtaatagcgctgtgaatacttcgaataacccaccagcgccgggatcccatcgtttcgtc
taa

DBGET integrated database retrieval system