KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4503
Entry
ECRM13516_4503    CDS       T03011                                 
Symbol
espG
Name
(GenBank) T3SS secreted effector protein EspG
  KO
K12785  LEE-encoded effector EspG
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_4503 (espG)
SSDB
Motif
Pfam: EspG ASXH
Other DBs
NCBI-ProteinID: AHG17118
LinkDB
Position
4455480..4456676
AA seq 398 aa
MILVAKLFITNQIGESLMINGLNNDSASLVLDAAMKVNSGFKKSWDEMSCAEKLFKVLSF
GLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSELVEAEIR
TANNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLS
TTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVDIPANAQKLLRDALGLKDTH
SSPTRNVIDHGISRHDAEQIARESSGSDKQKAEVVEFLCHPEAATAICSAFYQSFNVPAL
TLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYVTSHTGVLIMAPEDRPNEMGM
LTNRTSYEVPQGVKCIIDEMVSALQPRYAASETYLQNT
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgatacttgttgccaaattgttcattacaaaccagataggagaatctctcatgataaat
ggacttaataatgactccgcatctttagttttagatgctgcaatgaaagttaattctggg
tttaaaaaaagctgggatgagatgtcatgcgctgaaaagttatttaaagtacttagtttt
ggtttatggaatccaacgtacagtcgtagtgaaagacaatcatttcaagagttgttaacc
gttttagagcctgtatatccacttcccaatgaattaggcagagtatctgctcgtttttca
gatggttcatccttaagaatttccgtcactaacagcgaacttgttgaagccgagattcgc
acagcaaataatgaaaagattactgtgctcctggagtcaaacgaacaaaataggttatta
caatctttacccatcgatcgccacatgccatacattcaggttcatcgtgccttatctgag
atggacctgactgatactacctcaatgcgcaatctacttggttttacgtcaaaactatca
acaaccttgattcctcataatgctcaaacagatccgctttccgggcctacaccattcagc
tctatctttatggatacatgtcgaggactcggcaatgcaaagctttcactcaatggtgtt
gatatacctgcaaatgcacaaaaattgcttcgcgatgcactaggacttaaagacacacat
tcatcaccaacccggaatgttatagatcatggtatttctcgccatgatgcagagcaaata
gcaagagaaagcagcggcagtgataaacagaaagctgaagttgtggaatttttatgccat
ccagaagcagcaacggccatatgctcggctttctatcaatctttcaatgtgccagcctta
acgttgacacatgaaaggatctctaaagccagtgaatacaatgcggaaagatcgttagat
acacctaacgcttgcattaacatcagtatctctcaatcatcagatggaaacatttatgtt
accagccatactggggttctgataatggcgccagaagaccgccccaacgagatgggcatg
ttgacgaacaggacttcttatgaagtgccgcaaggtgtgaaatgtataatcgatgaaatg
gtaagtgcgctacaaccaaggtatgccgcatctgaaacgtacttacaaaacacttaa

DBGET integrated database retrieval system