Etheostoma cragini (Arkansas darter): 117958649 Help Entry 117958649         CDS       T07493                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ecra  Etheostoma cragini (Arkansas darter) Pathway ecra03420   Nucleotide excision repair ecra04110   Cell cycle ecra04114   Oocyte meiosis ecra04120   Ubiquitin mediated proteolysis ecra04141   Protein processing in endoplasmic reticulum ecra04310   Wnt signaling pathway ecra04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ecra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117958649 (rbx1)    04120 Ubiquitin mediated proteolysis     117958649 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     117958649 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117958649 (rbx1)    04350 TGF-beta signaling pathway     117958649 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     117958649 (rbx1)    04114 Oocyte meiosis     117958649 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ecra04121]     117958649 (rbx1)    03400 DNA repair and recombination proteins [BR:ecra03400]     117958649 (rbx1) Enzymes [BR:ecra01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117958649 (rbx1) Ubiquitin system [BR:ecra04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117958649 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      117958649 (rbx1)    Cul2 complex      117958649 (rbx1)    Cul3 complex      117958649 (rbx1)    Cul4 complex      117958649 (rbx1)    Cul7 complex      117958649 (rbx1)    Cul8 complex      117958649 (rbx1)    Cul9 complex      117958649 (rbx1) DNA repair and recombination proteins [BR:ecra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117958649 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       117958649 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  117958649 NCBI-ProteinID:  XP_034751049 LinkDB All DBs Position 15:3504997..3507982 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtagatacgccaagcggcacaaacagtggagccagcaaaaag cgatttgaagtaaagaagtggaatgctgtggcactgtgggcctgggacattgtggtggat aactgtgccatctgtcggaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttctgcaacctctgaggagtgcactgtagcctggggtgtctgcaaccatgccttccat ttccactgtatttcccgctggctgaaaaccagacaggtttgccctctggacaacagggag tgggagtttcagaaatacggacactag

DBGET integrated database retrieval system