Entamoeba dispar: EDI_254030 Help Entry EDI_254030        CDS       T01083                                  Name (RefSeq) RING-box protein pip1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism edi  Entamoeba dispar Pathway edi03420   Nucleotide excision repair edi04120   Ubiquitin mediated proteolysis edi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:edi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     EDI_254030    04120 Ubiquitin mediated proteolysis     EDI_254030   09124 Replication and repair    03420 Nucleotide excision repair     EDI_254030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:edi04121]     EDI_254030    03400 DNA repair and recombination proteins [BR:edi03400]     EDI_254030 Enzymes [BR:edi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      EDI_254030 Ubiquitin system [BR:edi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    EDI_254030   Multi subunit type E3    SCF complex     Ring finger protein      EDI_254030    Cul2 complex      EDI_254030    Cul3 complex      EDI_254030    Cul4 complex      EDI_254030    Cul7 complex      EDI_254030    Cul8 complex      EDI_254030    Cul9 complex      EDI_254030 DNA repair and recombination proteins [BR:edi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       EDI_254030     TCR (transcription coupled repair) factors      Cul4-CSA complex       EDI_254030 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-Nse PHD_NSD zf-RING_UBOX FANCL_C zf-HC5HC2H_2 zf-RING_16 Motif Other DBs NCBI-GeneID:  5879292 NCBI-ProteinID:  XP_001734385 UniProt:  B0E7N2 LinkDB All DBs AA seq 94 aa AA seqDB search MSAQQPPKFEIKKWNAVALWSWDLQVDTCAICRNSLMELCLECQGNTGSTTEECTVSWGT CNHAFHTHCISSWLRQRAVCPLDLKQWEYARIGK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtctgcacaacaaccacctaaattcgaaataaagaaatggaacgctgttgctttgtgg tcgtgggatcttcaagtagatacttgtgctatttgcagaaatagtcttatggaattatgt ctagaatgtcaaggaaatacaggttcaacaactgaagaatgtactgtttcatggggaact tgtaatcacgcattccatactcattgcatttcttcatggttaagacaacgtgctgtctgt cctcttgatctcaagcaatgggaatatgctcgtattggtaagtaa

DBGET integrated database retrieval system