Edwardsiella sp. LADL05-105: AAZ33_02825 Help Entry AAZ33_02825       CDS       T04005                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism edl  Edwardsiella sp. LADL05-105 Pathway edl00670   One carbon pool by folate edl00790   Folate biosynthesis edl01100   Metabolic pathways edl01240   Biosynthesis of cofactors edl04981   Folate transport and metabolism Module edl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:edl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AAZ33_02825 (folA)    00670 One carbon pool by folate     AAZ33_02825 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     AAZ33_02825 (folA) Enzymes [BR:edl01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      AAZ33_02825 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AKR76812 UniProt:  A0AAC9ET92 LinkDB All DBs Position 621816..622298 Genome browser AA seq 160 aa AA seqDB search MIISLIAALSADRVIGLDNAMPWHLPADLAWFKRNTLAKPVIMGRKTYESIGRPLPGRHN IVISRQAGSDDRVTWVTTPQAALDAAAEAQEVMIIGGGSIYSQFLPQASRLYLTHVDADV AGDTYFPDYASDEWQTCFSEFHDADSDNSHAYCFEILDRR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgccgcactgagcgcggatcgtgtgatcggtttagacaatgcg atgccgtggcatttgccggccgatcttgcgtggtttaagcgtaatactctggcaaaaccg gtgatcatggggcgtaagacctatgagtccatcgggcgtccgctgccggggcggcataac atcgtgatcagccgccaggcgggcagcgacgatcgcgtaacctgggtgacgacgccgcag gcggcgctggacgcagctgcggaggcgcaagaggtgatgatcatcggcggaggcagcatt tacagccagtttttgccgcaggcgagccggctgtatctgacccatgtggacgctgacgtc gcaggggacacctattttcccgactatgcgtcggatgagtggcagacgtgcttcagcgag tttcatgacgccgatagcgacaattcacacgcctattgctttgagatcctggatcgccgt taa

DBGET integrated database retrieval system