Enterobacter dykesii: F0320_03100 Help Entry F0320_03100       CDS       T10162                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism edy  Enterobacter dykesii Pathway edy00670   One carbon pool by folate edy00790   Folate biosynthesis edy01100   Metabolic pathways edy01240   Biosynthesis of cofactors edy04981   Folate transport and metabolism Module edy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:edy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     F0320_03100 (folA)    00670 One carbon pool by folate     F0320_03100 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     F0320_03100 (folA) Enzymes [BR:edy01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      F0320_03100 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  XBN40415 UniProt:  A0AAU7J398 LinkDB All DBs Position 661648..662127 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRTTLNKPVVMGRLTWESIGRPLPGRKNI VISSQPGTDDRVEWVKSVDEAIAACGNAEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgcagcgctggcggtggaccgcgttatcggtatggaaaatgccatg ccgtggaacctgcctgccgatctcgcatggtttaaacgtactacgttaaacaagccggta gtgatgggccgcctgacctgggagtcgattggtcgtccattgccgggtcgtaagaatatc gttatcagcagccagccgggcactgacgatcgcgtcgaatgggtaaaatcagtagacgag gcgattgctgcatgcggcaatgccgaagagatcatggtgattggcggtgggcgcgtgtac gagcagttcctgccaaaagcgcagaagctgtatctgacccacattgatgcagaagtggaa ggggatacccatttcccggactacgatccggacgagtgggaatcggtattcagcgaattc cacgacgcggatgcacagaactcccacagctactgcttcgagattctggaacgtcgttaa

DBGET integrated database retrieval system