Electrophorus electricus (electric eel): 113587186 Help Entry 113587186         CDS       T05787                                  Name (RefSeq) thymosin beta-12-like   KO K05764   thymosin, beta 4 Organism eee  Electrophorus electricus (electric eel) Pathway eee04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113587186  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eee04812]     113587186 Cytoskeleton proteins [BR:eee04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      113587186 SSDB OrthologParalogGFIT Motif Pfam:  Thymosin DUF4522 Motif Other DBs NCBI-GeneID:  113587186 NCBI-ProteinID:  XP_026881543 UniProt:  A0A4W4E0K2 LinkDB All DBs Position Unknown AA seq 45 aa AA seqDB search MSDKPDLTEIARFDKTKLKKTETKEKNPLPTKETIEQERKGDASP NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagccagacctcactgagatcgccaggtttgacaaaaccaagttgaagaag accgagacaaaagagaagaaccccctgcccaccaaagagaccatcgagcaggagaggaaa ggagatgcaagcccctga

DBGET integrated database retrieval system