Enterococcus faecalis V583: EF1577 Help Entry EF1577            CDS       T00123                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism efa  Enterococcus faecalis V583 Pathway efa00670   One carbon pool by folate efa00790   Folate biosynthesis efa01100   Metabolic pathways efa01240   Biosynthesis of cofactors efa04981   Folate transport and metabolism Module efa_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:efa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EF1577 (folA)    00670 One carbon pool by folate     EF1577 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     EF1577 (folA) Enzymes [BR:efa01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      EF1577 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAO81364 UniProt:  Q834R2 Structure PDBPDBj LinkDB All DBs Position 1530013..1530507 Genome browser AA seq 164 aa AA seqDB search MLAAIWAQDEQGVIGKEGKLPWHLPNDLKFFKEKTIHNTLVLGRATFEGMGCRPLPNRTT IVLTSNPDYQAEGVLVMHSVEEILAYADKYEGVTVIGGGSVVFKELIPACDVLYRTMIHE TFEGDTFFPEIDWSVWEKVATVPGVVDEKNLYAHDYETYHRNDK NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgttagcagccatttgggcccaagatgaacaaggagtgattggtaaagaaggcaaattg ccttggcatttacccaacgacttgaaatttttcaaggaaaaaacaattcataatacattg gttttaggacgtgcaactttcgaaggtatgggatgtcgtccgttaccaaatcgaacaacg attgttcttaccagtaatccggattaccaagctgaaggcgttttggttatgcattccgta gaggaaattcttgcgtatgctgacaagtatgaaggcgtgaccgttattggtggaggttct gtcgtttttaaagaattgattcccgcatgcgatgtcttatatcggacgatgattcatgaa acgtttgaaggcgacaccttctttccagaaatcgactggtctgtttgggaaaaagttgcc actgttcccggcgtcgtggacgagaaaaatctctatgcacatgactatgaaacgtatcat cgaaacgataaataa

DBGET integrated database retrieval system