Candidatus Endolissoclinum faulkneri L5: P856_432 Help Entry P856_432          CDS       T04221                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism efk  Candidatus Endolissoclinum faulkneri L5 Pathway efk00670   One carbon pool by folate efk00790   Folate biosynthesis efk01100   Metabolic pathways efk01240   Biosynthesis of cofactors efk04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:efk00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     P856_432 (folA)    00670 One carbon pool by folate     P856_432 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     P856_432 (folA) Enzymes [BR:efk01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      P856_432 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AHC73650 UniProt:  V9TWF1 LinkDB All DBs Position 723656..724138 Genome browser AA seq 160 aa AA seqDB search MADNMVIGRSNAGLPWSIPKDLARFKRLTLGHSILMGRRTWETIGYPLPLRRSIVLTRDI NWVANGAYRVKDLDTAIAVCSEEKEIFIIGGSEIFALTIPLADSLSLTFIHSQACGDVKF PKINWFAWSEIWRENHVAEDSRPAFTFTTYVRAQVRYYNR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggctgacaacatggtaatcggtcgtagtaatgctgggttaccttggtcaatacctaag gatcttgctcgttttaaacgtcttacactgggtcacagcatattaatgggtcgccgtacc tgggagacaattggctaccctctgccccttcgacgatcaatagttttaactcgtgatatc aactgggttgcaaatggagcatatcgagtaaaagatttggatactgccatcgcagtatgt agtgaagaaaaggaaatatttatcattggcggaagcgaaatctttgctttaactattcct ttggctgattctttatctcttacttttatacattcacaggcgtgtggtgatgttaaattt ccaaagattaattggtttgcttggagcgaaatctggagagaaaatcatgtagctgaagat agtcgaccggcatttacttttactacttatgtgcgcgcccaggtacgatactacaatcgt taa

DBGET integrated database retrieval system