Enterococcus faecalis Symbioflor 1: EFS1_1333 Help Entry EFS1_1333         CDS       T02399                                  Symbol dfrA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism efs  Enterococcus faecalis Symbioflor 1 Pathway efs00670   One carbon pool by folate efs00790   Folate biosynthesis efs01100   Metabolic pathways efs01240   Biosynthesis of cofactors efs04981   Folate transport and metabolism Module efs_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:efs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EFS1_1333 (dfrA)    00670 One carbon pool by folate     EFS1_1333 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     EFS1_1333 (dfrA) Enzymes [BR:efs01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      EFS1_1333 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CCO72411 LinkDB All DBs Position 1379346..1379840 Genome browser AA seq 164 aa AA seqDB search MLAAIWAQDEQGVIGKEGKLPWHLPNDLKFFKEKTIHNTLVLGRATFEGMGCRPLPNRTT IVLTSNPDYQAEGVLVMHSVEEILAYADKYEGVTVIGGGSVVFKELIPACDVLYRTMIHE TFEGDTFFPEIDWSVWEKVATVPGVVDEKNLYAHDYETYHRNDK NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgttagcagccatttgggcccaagatgaacaaggagtgattggtaaagaaggcaaattg ccttggcatttacccaacgacttgaaatttttcaaggaaaaaacaattcataatacattg gtcttaggacgtgcaactttcgaaggcatgggatgtcgtccgttaccaaatcgaacaacg attgttcttaccagtaatccggattaccaagctgaaggcgttttggttatgcattccgta gaggaaattcttgcgtatgctgacaagtatgaaggcgtgaccgttattggtggaggttct gtcgtttttaaagaactgattcccgcatgcgatgtcttatatcggacaatgattcatgaa acgtttgaaggcgacactttctttccagaaatcgactggtctgtttgggaaaaagttgcc actgttcccggcgtcgtggacgagaaaaatctctatgcacatgactatgaaacgtatcat cgaaacgataaataa

DBGET integrated database retrieval system