Eptesicus fuscus (big brown bat): 103283560 Help Entry 103283560         CDS       T09083                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01522   Endocrine resistance efus04010   MAPK signaling pathway efus04024   cAMP signaling pathway efus04210   Apoptosis efus04380   Osteoclast differentiation efus04620   Toll-like receptor signaling pathway efus04657   IL-17 signaling pathway efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04668   TNF signaling pathway efus04713   Circadian entrainment efus04725   Cholinergic synapse efus04728   Dopaminergic synapse efus04915   Estrogen signaling pathway efus04917   Prolactin signaling pathway efus04921   Oxytocin signaling pathway efus04926   Relaxin signaling pathway efus04928   Parathyroid hormone synthesis, secretion and action efus04932   Non-alcoholic fatty liver disease efus04935   Growth hormone synthesis, secretion and action efus05031   Amphetamine addiction efus05132   Salmonella infection efus05133   Pertussis efus05135   Yersinia infection efus05140   Leishmaniasis efus05142   Chagas disease efus05161   Hepatitis B efus05162   Measles efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05171   Coronavirus disease efus05200   Pathways in cancer efus05207   Chemical carcinogenesis - receptor activation efus05208   Chemical carcinogenesis - reactive oxygen species efus05210   Colorectal cancer efus05224   Breast cancer efus05231   Choline metabolism in cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05323   Rheumatoid arthritis efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103283560 (FOS)    04668 TNF signaling pathway     103283560 (FOS)    04024 cAMP signaling pathway     103283560 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103283560 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103283560 (FOS)    04660 T cell receptor signaling pathway     103283560 (FOS)    04658 Th1 and Th2 cell differentiation     103283560 (FOS)    04659 Th17 cell differentiation     103283560 (FOS)    04657 IL-17 signaling pathway     103283560 (FOS)    04662 B cell receptor signaling pathway     103283560 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     103283560 (FOS)    04917 Prolactin signaling pathway     103283560 (FOS)    04921 Oxytocin signaling pathway     103283560 (FOS)    04926 Relaxin signaling pathway     103283560 (FOS)    04935 Growth hormone synthesis, secretion and action     103283560 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     103283560 (FOS)   09156 Nervous system    04725 Cholinergic synapse     103283560 (FOS)    04728 Dopaminergic synapse     103283560 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     103283560 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     103283560 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103283560 (FOS)    05207 Chemical carcinogenesis - receptor activation     103283560 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     103283560 (FOS)    05231 Choline metabolism in cancer     103283560 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103283560 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     103283560 (FOS)    05224 Breast cancer     103283560 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103283560 (FOS)    05170 Human immunodeficiency virus 1 infection     103283560 (FOS)    05161 Hepatitis B     103283560 (FOS)    05171 Coronavirus disease     103283560 (FOS)    05162 Measles     103283560 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     103283560 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103283560 (FOS)    05135 Yersinia infection     103283560 (FOS)    05133 Pertussis     103283560 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103283560 (FOS)    05142 Chagas disease     103283560 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     103283560 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     103283560 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103283560 (FOS)    05418 Fluid shear stress and atherosclerosis     103283560 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103283560 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103283560 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:efus03000]     103283560 (FOS)    04131 Membrane trafficking [BR:efus04131]     103283560 (FOS) Transcription factors [BR:efus03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     103283560 (FOS) Membrane trafficking [BR:efus04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     103283560 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 HALZ Macoilin Motif Other DBs NCBI-GeneID:  103283560 NCBI-ProteinID:  XP_008137038 LinkDB All DBs Position 5:complement(21790911..21794364) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLASSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAHHPYGVPAPSAGAYSRAGVMKTVTGSRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLNGGLPEAATPESEEAFA LPLLSDPEPKPAVEPIKNVRSMELKAEPFDDFLFPASSRPSGSETSRSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcaggcttcaatgcggactacgaggcgtcctcgtcccgctgtagcagcgcc tccccggccggggacagcctctcttactaccactcaccggccgactccttctccagcatg ggctcccctgtcaatgcgcaggacttttgcacggatctggcgtcctccagtgccaacttc atcccaactgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcccact ctagtctcctcggtggccccatcccagaccagagcccaccacccctacggggtccccgcc ccctcggcgggggcttactccagggccggcgtcatgaagacggtgacaggaagcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg cgaatccgaagggaaaggaataagatggctgcagccaaatgccggaatcggaggagggag ctgactgacacactccaagcggagacagaccaactagaggacgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccccgatgacctgggcttcccagaagagatgtctgtggcttcc ctggatctgaatggaggcctgcctgaggctgccacccctgagtccgaggaggccttcgcc ttgcccctcctcagtgaccctgagcccaagcctgcagtggagcccatcaaaaacgtgcgc agcatggagctgaaggctgagccctttgatgacttcctgttcccggcatcgtccaggccc agcggctctgagacctcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggatggggcccatggccacagagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcaccacttacacgtcttcc tttgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgtaag ggcagcagcagcaacgagccctcctctgattcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system