Eptesicus fuscus (big brown bat): 103289195 Help Entry 103289195         CDS       T09083                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04060   Cytokine-cytokine receptor interaction efus04151   PI3K-Akt signaling pathway efus04217   Necroptosis efus04380   Osteoclast differentiation efus04620   Toll-like receptor signaling pathway efus04621   NOD-like receptor signaling pathway efus04622   RIG-I-like receptor signaling pathway efus04623   Cytosolic DNA-sensing pathway efus04630   JAK-STAT signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04668   TNF signaling pathway efus04936   Alcoholic liver disease efus05135   Yersinia infection efus05142   Chagas disease efus05152   Tuberculosis efus05160   Hepatitis C efus05161   Hepatitis B efus05162   Measles efus05163   Human cytomegalovirus infection efus05164   Influenza A efus05165   Human papillomavirus infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05168   Herpes simplex virus 1 infection efus05169   Epstein-Barr virus infection efus05170   Human immunodeficiency virus 1 infection efus05171   Coronavirus disease - COVID-19 efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103289195 (IFNB1)    04668 TNF signaling pathway     103289195 (IFNB1)    04151 PI3K-Akt signaling pathway     103289195 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103289195 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103289195 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103289195 (IFNB1)    04621 NOD-like receptor signaling pathway     103289195 (IFNB1)    04622 RIG-I-like receptor signaling pathway     103289195 (IFNB1)    04623 Cytosolic DNA-sensing pathway     103289195 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     103289195 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     103289195 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103289195 (IFNB1)    05161 Hepatitis B     103289195 (IFNB1)    05160 Hepatitis C     103289195 (IFNB1)    05171 Coronavirus disease - COVID-19     103289195 (IFNB1)    05164 Influenza A     103289195 (IFNB1)    05162 Measles     103289195 (IFNB1)    05168 Herpes simplex virus 1 infection     103289195 (IFNB1)    05163 Human cytomegalovirus infection     103289195 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     103289195 (IFNB1)    05169 Epstein-Barr virus infection     103289195 (IFNB1)    05165 Human papillomavirus infection     103289195 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     103289195 (IFNB1)    05152 Tuberculosis     103289195 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     103289195 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103289195 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103289195 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103289195 (IFNB1) Cytokines and neuropeptides [BR:efus04052]  Cytokines   Interferons    103289195 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon AAA_lid_11 Motif Other DBs NCBI-GeneID:  103289195 NCBI-ProteinID:  XP_008143266 LinkDB All DBs Position 15:17347661..17348221 Genome browser AA seq 186 aa AA seqDB search MTNRCVLQLTVLLCLTSAALSVNYGVLRFRQRSSNSACLELLRQLIRSPQNCLGDTMDFQ IPKEVKQPQQVQKEEAMVVMHEMFHQIFSIFRRSFSSTGWNETIVESLLEELHWQMDRLE TALKETLQEGKFPWENRTVLRLKTYYLGILQYLKAKSYSQCAWTVVQVEILRNFSFLNGL IDALQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgcgtcctccagctcaccgtcctgctgtgcctcaccagcgccgcgctc tccgtgaactacggcgtgctccgattccgacagagaagcagcaattcagcctgtctggag ctcctgcggcagctgattagaagccctcagaattgtctgggtgacacgatggacttccag atccccaaggaggttaaacagccacagcaggtccagaaggaggaagccatggtggtcatg catgagatgttccatcagatcttcagcattttccgaagaagtttctccagcaccggctgg aatgagaccatcgtcgagagccttctggaggagctccattggcagatggaccgcctggag acagccctgaaggaaaccttgcaggagggaaagttcccctgggaaaacaggaccgtgctg cgcctgaagacctactacttaggcatcctacagtacctgaaggccaagtcctacagccaa tgtgcctggactgtcgtccaagtggaaatcctcaggaacttctccttccttaatggactc atagatgccctccaggactga

DBGET integrated database retrieval system