Eptesicus fuscus (big brown bat): 103290101 Help Entry 103290101         CDS       T09083                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04060   Cytokine-cytokine receptor interaction efus04151   PI3K-Akt signaling pathway efus04630   JAK-STAT signaling pathway efus04640   Hematopoietic cell lineage efus04657   IL-17 signaling pathway efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04664   Fc epsilon RI signaling pathway efus04672   Intestinal immune network for IgA production efus05140   Leishmaniasis efus05200   Pathways in cancer efus05310   Asthma efus05320   Autoimmune thyroid disease efus05321   Inflammatory bowel disease efus05330   Allograft rejection Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103290101 (IL4)    04151 PI3K-Akt signaling pathway     103290101 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103290101 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103290101 (IL4)    04660 T cell receptor signaling pathway     103290101 (IL4)    04658 Th1 and Th2 cell differentiation     103290101 (IL4)    04659 Th17 cell differentiation     103290101 (IL4)    04657 IL-17 signaling pathway     103290101 (IL4)    04664 Fc epsilon RI signaling pathway     103290101 (IL4)    04672 Intestinal immune network for IgA production     103290101 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103290101 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103290101 (IL4)   09163 Immune disease    05310 Asthma     103290101 (IL4)    05320 Autoimmune thyroid disease     103290101 (IL4)    05321 Inflammatory bowel disease     103290101 (IL4)    05330 Allograft rejection     103290101 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103290101 (IL4)    00536 Glycosaminoglycan binding proteins [BR:efus00536]     103290101 (IL4) Cytokines and neuropeptides [BR:efus04052]  Cytokines   Interleukins    103290101 (IL4) Glycosaminoglycan binding proteins [BR:efus00536]  Heparan sulfate / Heparin   Cytokines    103290101 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 IL13 INT1_R3 Motif Other DBs NCBI-GeneID:  103290101 NCBI-ProteinID:  XP_008144255 LinkDB All DBs Position 6:73442825..73450853 Genome browser AA seq 136 aa AA seqDB search MGLTSQLIPALVCLLACTSNFTHGHKYNLTLRETIKTLNILTAKKDPRCMELTVADVLAA PKNTTEEETFCRAAAALRQVYRHHPCLTKRFLSGLDRNLSSMANKTSCPVNEAKMTTLKD FLERLKSIMQEKYSKG NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacgtcccagctgattccagctctggtctgcttactagcatgtaccagcaac ttcacccatggacacaagtacaacctcaccttacgagagaccatcaaaacgctgaacatc ctcacagcgaaaaaggacccacggtgcatggagctgaccgtagcagacgtcttggctgcc ccgaagaacacaacggaggaggaaaccttctgcagggccgcggcggcgctccggcaggtc tacaggcaccacccgtgcttgaccaaaaggttcctgagcggacttgacaggaacctcagc agcatggccaacaagacctcctgtcctgtgaacgaagccaagatgacgacactgaaagac ttcttggaaaggttaaagagcatcatgcaagagaaatactcaaagggttga

DBGET integrated database retrieval system