Eptesicus fuscus (big brown bat): 103292358 Help Entry 103292358         CDS       T09083                                  Symbol MYC Name (RefSeq) myc proto-oncogene protein   KO K04377   Myc proto-oncogene protein Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04010   MAPK signaling pathway efus04012   ErbB signaling pathway efus04110   Cell cycle efus04151   PI3K-Akt signaling pathway efus04218   Cellular senescence efus04310   Wnt signaling pathway efus04350   TGF-beta signaling pathway efus04390   Hippo signaling pathway efus04550   Signaling pathways regulating pluripotency of stem cells efus04630   JAK-STAT signaling pathway efus04919   Thyroid hormone signaling pathway efus05132   Salmonella infection efus05160   Hepatitis C efus05161   Hepatitis B efus05163   Human cytomegalovirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05169   Epstein-Barr virus infection efus05200   Pathways in cancer efus05202   Transcriptional misregulation in cancer efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05207   Chemical carcinogenesis - receptor activation efus05210   Colorectal cancer efus05213   Endometrial cancer efus05216   Thyroid cancer efus05219   Bladder cancer efus05220   Chronic myeloid leukemia efus05221   Acute myeloid leukemia efus05222   Small cell lung cancer efus05224   Breast cancer efus05225   Hepatocellular carcinoma efus05226   Gastric cancer efus05230   Central carbon metabolism in cancer Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103292358 (MYC)    04012 ErbB signaling pathway     103292358 (MYC)    04310 Wnt signaling pathway     103292358 (MYC)    04350 TGF-beta signaling pathway     103292358 (MYC)    04390 Hippo signaling pathway     103292358 (MYC)    04630 JAK-STAT signaling pathway     103292358 (MYC)    04151 PI3K-Akt signaling pathway     103292358 (MYC)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103292358 (MYC)    04218 Cellular senescence     103292358 (MYC)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103292358 (MYC)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     103292358 (MYC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103292358 (MYC)    05202 Transcriptional misregulation in cancer     103292358 (MYC)    05206 MicroRNAs in cancer     103292358 (MYC)    05205 Proteoglycans in cancer     103292358 (MYC)    05207 Chemical carcinogenesis - receptor activation     103292358 (MYC)    05230 Central carbon metabolism in cancer     103292358 (MYC)   09162 Cancer: specific types    05210 Colorectal cancer     103292358 (MYC)    05225 Hepatocellular carcinoma     103292358 (MYC)    05226 Gastric cancer     103292358 (MYC)    05216 Thyroid cancer     103292358 (MYC)    05221 Acute myeloid leukemia     103292358 (MYC)    05220 Chronic myeloid leukemia     103292358 (MYC)    05219 Bladder cancer     103292358 (MYC)    05213 Endometrial cancer     103292358 (MYC)    05224 Breast cancer     103292358 (MYC)    05222 Small cell lung cancer     103292358 (MYC)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103292358 (MYC)    05161 Hepatitis B     103292358 (MYC)    05160 Hepatitis C     103292358 (MYC)    05163 Human cytomegalovirus infection     103292358 (MYC)    05167 Kaposi sarcoma-associated herpesvirus infection     103292358 (MYC)    05169 Epstein-Barr virus infection     103292358 (MYC)   09171 Infectious disease: bacterial    05132 Salmonella infection     103292358 (MYC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:efus03000]     103292358 (MYC)    03019 Messenger RNA biogenesis [BR:efus03019]     103292358 (MYC) Transcription factors [BR:efus03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Myc     103292358 (MYC) Messenger RNA biogenesis [BR:efus03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103292358 (MYC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Myc_N Myc-LZ HLH Motif Other DBs NCBI-GeneID:  103292358 NCBI-ProteinID:  XP_054564469 LinkDB All DBs Position 19:complement(6585593..6590538) Genome browser AA seq 443 aa AA seqDB search MPLNVSFANRNYDLDYDSMQPYFFCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAFASFSPRDVDDGGGGGGGGSFSTADQLEMVTELLGGDMVNQSFI CDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGGRSPARGQGACSTSSL YLQDLSAAASECIDPSVVFPYPLNDGSSPKPCASPDSTAFSPSSDSLLSSTDSSPRASPE PLALHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPSAKRSESGSPSSRSHSKPPHSPLV LKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRRCASPRSSDTEENDKR RTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILAIQAEEQKLLSE KDFLRKRREQLKHKLEQLRNSCA NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcgatgcag ccctatttcttctgcgacgaggaggagaacttctaccaccagcagcagcagagcgagctg cagccgcccgcgcccagcgaggacatctggaagaaattcgagctgctgcccacgccgccc ctgtcgcccagccgccgctccggactctgctcgccctcctacgtcgccttcgcgtccttc tccccgcgggacgtggacgacggcggcggcggcggcggcggcggcagcttctccaccgcc gaccagctggagatggtgaccgagctgctgggaggggacatggtgaaccagagcttcatc tgcgacccggacgacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagc ggcttctcggccgccgccaagctcgtctccgagaagctggcctcctaccaggctgcgcgc aaagacggcggcggccggagccccgcccgcgggcagggcgcctgctccacctccagcctg tacctgcaggacctgagcgccgccgcctccgagtgcatcgacccctccgtggtcttcccc tacccgctcaacgacggcagctcgcccaagccctgcgcctcccccgactccaccgccttc tccccgtcctcggactctctgctctcctccaccgactcctccccgcgggccagccccgag cccctggcgctccacgaggagacaccacccaccaccagcagcgactccgaggaagagcaa gaggatgaggaagaaatcgatgttgtttctgtggagaagaggcagccctcggccaagagg tcagaatcagggtccccctcttccagaagccacagcaaaccgccccacagcccgctggtc cttaagcggtgccacgtgtccacccaccagcacaattacgcggcgcccccctccacccgg aaggactaccccgccgccaagagggctaagttggacagtggccgcgtcctcaaacagatc agcaacaaccgcagatgcgccagccccaggtcctcggacacggaggagaacgacaagcgg cggacgcacaacgtcctggagcgccagaggaggaacgagctgaaacgcagcttcttcgcg ctgcgcgaccagatccccgagttggaaaacaacgagaaggcccccaaggtggtgatcctg aagaaggccaccgcctacatcctggccatccaagcggaggagcagaagctcctctcggag aaggacttcttgcggaaacggcgcgaacagttgaaacacaaacttgaacagctgcggaac tcttgtgcctaa

DBGET integrated database retrieval system