Eptesicus fuscus (big brown bat): 103292519 Help Entry 103292519         CDS       T09083                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04010   MAPK signaling pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04024   cAMP signaling pathway efus04062   Chemokine signaling pathway efus04510   Focal adhesion efus04517   IgSF CAM signaling efus04520   Adherens junction efus04611   Platelet activation efus04670   Leukocyte transendothelial migration efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04934   Cushing syndrome efus04972   Pancreatic secretion efus05211   Renal cell carcinoma efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103292519 (RAP1B)    04014 Ras signaling pathway     103292519 (RAP1B)    04015 Rap1 signaling pathway     103292519 (RAP1B)    04024 cAMP signaling pathway     103292519 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103292519 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103292519 (RAP1B)    04520 Adherens junction     103292519 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103292519 (RAP1B)    04670 Leukocyte transendothelial migration     103292519 (RAP1B)    04062 Chemokine signaling pathway     103292519 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     103292519 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     103292519 (RAP1B)    04722 Neurotrophin signaling pathway     103292519 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     103292519 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103292519 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     103292519 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103292519 (RAP1B)    04031 GTP-binding proteins [BR:efus04031]     103292519 (RAP1B) Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103292519 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    103292519 (RAP1B)   Exosomal proteins of colorectal cancer cells    103292519 (RAP1B) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     103292519 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  103292519 NCBI-ProteinID:  XP_008146994 LinkDB All DBs Position 7:complement(43347395..43396431) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttac agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacaatccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system