Eptesicus fuscus (big brown bat): 103302255 Help Entry 103302255         CDS       T09083                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01523   Antifolate resistance efus04010   MAPK signaling pathway efus04014   Ras signaling pathway efus04062   Chemokine signaling pathway efus04064   NF-kappa B signaling pathway efus04151   PI3K-Akt signaling pathway efus04210   Apoptosis efus04380   Osteoclast differentiation efus04620   Toll-like receptor signaling pathway efus04621   NOD-like receptor signaling pathway efus04622   RIG-I-like receptor signaling pathway efus04623   Cytosolic DNA-sensing pathway efus04625   C-type lectin receptor signaling pathway efus04657   IL-17 signaling pathway efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04668   TNF signaling pathway efus04920   Adipocytokine signaling pathway efus04936   Alcoholic liver disease efus05010   Alzheimer disease efus05132   Salmonella infection efus05135   Yersinia infection efus05142   Chagas disease efus05145   Toxoplasmosis efus05160   Hepatitis C efus05161   Hepatitis B efus05162   Measles efus05163   Human cytomegalovirus infection efus05164   Influenza A efus05165   Human papillomavirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05168   Herpes simplex virus 1 infection efus05169   Epstein-Barr virus infection efus05170   Human immunodeficiency virus 1 infection efus05171   Coronavirus disease - COVID-19 efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05208   Chemical carcinogenesis - reactive oxygen species efus05212   Pancreatic cancer efus05215   Prostate cancer efus05220   Chronic myeloid leukemia efus05221   Acute myeloid leukemia efus05222   Small cell lung cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05340   Primary immunodeficiency efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103302255 (IKBKG)    04014 Ras signaling pathway     103302255 (IKBKG)    04064 NF-kappa B signaling pathway     103302255 (IKBKG)    04668 TNF signaling pathway     103302255 (IKBKG)    04151 PI3K-Akt signaling pathway     103302255 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103302255 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103302255 (IKBKG)    04621 NOD-like receptor signaling pathway     103302255 (IKBKG)    04622 RIG-I-like receptor signaling pathway     103302255 (IKBKG)    04623 Cytosolic DNA-sensing pathway     103302255 (IKBKG)    04625 C-type lectin receptor signaling pathway     103302255 (IKBKG)    04660 T cell receptor signaling pathway     103302255 (IKBKG)    04658 Th1 and Th2 cell differentiation     103302255 (IKBKG)    04659 Th17 cell differentiation     103302255 (IKBKG)    04657 IL-17 signaling pathway     103302255 (IKBKG)    04662 B cell receptor signaling pathway     103302255 (IKBKG)    04062 Chemokine signaling pathway     103302255 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103302255 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     103302255 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103302255 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     103302255 (IKBKG)    05203 Viral carcinogenesis     103302255 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103302255 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     103302255 (IKBKG)    05221 Acute myeloid leukemia     103302255 (IKBKG)    05220 Chronic myeloid leukemia     103302255 (IKBKG)    05215 Prostate cancer     103302255 (IKBKG)    05222 Small cell lung cancer     103302255 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103302255 (IKBKG)    05170 Human immunodeficiency virus 1 infection     103302255 (IKBKG)    05161 Hepatitis B     103302255 (IKBKG)    05160 Hepatitis C     103302255 (IKBKG)    05171 Coronavirus disease - COVID-19     103302255 (IKBKG)    05164 Influenza A     103302255 (IKBKG)    05162 Measles     103302255 (IKBKG)    05168 Herpes simplex virus 1 infection     103302255 (IKBKG)    05163 Human cytomegalovirus infection     103302255 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     103302255 (IKBKG)    05169 Epstein-Barr virus infection     103302255 (IKBKG)    05165 Human papillomavirus infection     103302255 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     103302255 (IKBKG)    05135 Yersinia infection     103302255 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103302255 (IKBKG)    05142 Chagas disease     103302255 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     103302255 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     103302255 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103302255 (IKBKG)    05418 Fluid shear stress and atherosclerosis     103302255 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103302255 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103302255 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:efus01001]     103302255 (IKBKG) Protein kinases [BR:efus01001]  Serine/threonine kinases: Other   IKK family [OT]    103302255 (IKBKG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CC2-LZ NEMO zf_C2H2_10 Golgin_A5 Nairovirus_NSm Motif Other DBs NCBI-GeneID:  103302255 NCBI-ProteinID:  XP_054569273 LinkDB All DBs Position 1:124863501..124878059 Genome browser AA seq 416 aa AA seqDB search MSRPPWKSPLCEMVQPSGGPAGDQDVLGEEPSLGKPAMLHLPSEHGAPETFQRCLEENQE LRDAIRQSNQMLRECCEELQRFQGSQREEKEFLMQKFQEARKLVERLNLEKLDLKRQREQ ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEVRARAASEQ ARQLESEREALQQQHSVQVDQLRMQNQSMEAALRMERQAASEEKRKLAQLQAAYHQLFQD YDNHMKSSLVSSERNRGMQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV LKAQADIYEADFQAERQAREKLAEKKELLQEQLEQLQREFSRLKASCQESARIEDMRKRH VEVSQPPAQAHQSFHPALFSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIQ NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt atgagcaggcccccctggaagagtccgctgtgtgagatggtgcagcccagcggtggcccg gctggggaccaggacgtgctgggtgaagagccttctctggggaagccggccatgctccac ctgccttcggagcacggtgctcccgagaccttccagcgctgcctggaggagaatcaagag ctccgagatgccatccggcagagcaaccagatgctgcgggagtgctgcgaggagttgcag cgtttccagggcagccagagggaggagaaggagttcctcatgcagaagttccaggaggcc aggaaactggtggagaggctgaacctggagaagctggacctgaagagacagagggagcag gccctacaggaggtggagcacctgaagcgatgccagcagcagatggctgaggacaaggcc tcggtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg gaggctgccaccaaggatcggcaggctttggaagtcagggcccgggcagccagtgagcag gcccggcagctggagagcgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac cagttgcgcatgcagaaccagagcatggaggctgctctgcgcatggagcgccaggctgcc tcggaggagaagaggaagctggcgcagctccaggcagcctatcaccagctcttccaagat tatgacaaccacatgaagagtagcctggtgagcagtgagcgaaaccgaggaatgcagctg gaagatctcaagcagcagctccagcaggctgaggaggccctagtggctaagcaggaattg atcgataagctgaaggaagaggccgagcagcacaagattgtgatggagaccgttccggtg ctcaaggcccaggcggatatctacgaggctgatttccaggctgagaggcaggcccgggag aagctggccgagaagaaggagctgctgcaggagcagctggagcagctgcagcgggagttc agcaggttgaaggccagctgtcaggagtcggccaggattgaagatatgaggaagcggcat gtagaggtctcccagccccctgcccaagctcaccagtcctttcaccccgccttgttcagc cagaggagaagcccccccgaggagccacctgacttctgttgccccaagtgccagtatcag gctcctgacatggacaccctgcagatccacgtcatggagtgcattcagtag

DBGET integrated database retrieval system