Eptesicus fuscus (big brown bat): 103302486 Help Entry 103302486         CDS       T09083                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus00510   N-Glycan biosynthesis efus00513   Various types of N-glycan biosynthesis efus04141   Protein processing in endoplasmic reticulum Module efus_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:efus00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     103302486    00513 Various types of N-glycan biosynthesis     103302486  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103302486 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  103302486 NCBI-ProteinID:  XP_054574383 LinkDB All DBs Position 1:126114486..126114749 Genome browser AA seq 79 aa AA seqDB search MELKAMSRYTSPVNPAAFPHLTVVLLAIGMFFTAWFFVCEVTSTKYTRDIYQELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcaaggccatgagcagatacaccagccccgtgaacccagccgccttcccccat ctgaccgtggtgctgttggccattggcatgttcttcaccgcctggttcttcgtctgtgag gtcacgtccaccaagtacactcgggacatctaccaggagctcctcatctccttggtggcc tcgctgttcatgggctttggggtcctctttctgctgctctgggttggcatctatgtatga

DBGET integrated database retrieval system