Elaeis guineensis (African oil palm): 105056281 Help Entry 105056281         CDS       T03921                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism egu  Elaeis guineensis (African oil palm) Pathway egu03420   Nucleotide excision repair egu04120   Ubiquitin mediated proteolysis egu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105056281    04120 Ubiquitin mediated proteolysis     105056281   09124 Replication and repair    03420 Nucleotide excision repair     105056281  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:egu04121]     105056281    03400 DNA repair and recombination proteins [BR:egu03400]     105056281 Enzymes [BR:egu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105056281 Ubiquitin system [BR:egu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105056281   Multi subunit type E3    SCF complex     Ring finger protein      105056281    Cul2 complex      105056281    Cul3 complex      105056281    Cul4 complex      105056281    Cul7 complex      105056281    Cul8 complex      105056281    Cul9 complex      105056281 DNA repair and recombination proteins [BR:egu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105056281     TCR (transcription coupled repair) factors      Cul4-CSA complex       105056281 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF4644 DUF8003 Motif Other DBs NCBI-GeneID:  105056281 NCBI-ProteinID:  XP_010936721 UniProt:  A0A6I9S438 LinkDB All DBs Position 13:complement(20553252..20562814) Genome browser AA seq 119 aa AA seqDB search MASLDTDINMVPVGEGSSGAAGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcatcgctggatacggacatcaacatggttcccgtcggcgagggatcaagcggcgcc gccgggccgtcgtcgtcctccaagaagccgaagcgcttcgagatcaagaagtggaacgcc gtcgccctttgggcctgggatatcgtcgtggataactgcgctatctgcagaaaccacatc atggatctctgcatcgagtgccaggcgaatcaagctagtgcgactagcgaggaatgcact gtcgcttggggtgtctgcaatcatgcttttcacttccattgcatcagtcggtggctcaag actcgtcaagtttgccctttggacaacagcgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system