Elaeis guineensis (African oil palm): 105058733 Help Entry 105058733         CDS       T03921                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism egu  Elaeis guineensis (African oil palm) Pathway egu03420   Nucleotide excision repair egu04120   Ubiquitin mediated proteolysis egu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105058733    04120 Ubiquitin mediated proteolysis     105058733   09124 Replication and repair    03420 Nucleotide excision repair     105058733  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:egu04121]     105058733    03400 DNA repair and recombination proteins [BR:egu03400]     105058733 Enzymes [BR:egu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105058733 Ubiquitin system [BR:egu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105058733   Multi subunit type E3    SCF complex     Ring finger protein      105058733    Cul2 complex      105058733    Cul3 complex      105058733    Cul4 complex      105058733    Cul7 complex      105058733    Cul8 complex      105058733    Cul9 complex      105058733 DNA repair and recombination proteins [BR:egu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105058733     TCR (transcription coupled repair) factors      Cul4-CSA complex       105058733 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 DUF4644 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  105058733 NCBI-ProteinID:  XP_010940054 UniProt:  A0A6I9SB02 LinkDB All DBs Position 15:complement(73551383..73561688) Genome browser AA seq 119 aa AA seqDB search MASLDTDINMVPAGEGSSGAAGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacacggacatcaacatggttcccgcaggcgagggatcgagcggtgcc gccgggccgtcgtcgtcctccaagaagccgaagcgcttcgagatcaagaagtggaacgct gtcgccctctgggcctgggatatcgtcgtggataactgcgctatttgcaggaaccacatc atggatctctgcatcgagtgccaggcgaaccaggccagtgcgactagcgaagaatgcacc gttgcttggggtgtctgcaatcatgcttttcacttccactgcatcagtcggtggcttaag actcgtcaagtttgccctttggacaacagtgagtgggagttccagaaatatggccactga

DBGET integrated database retrieval system