Egretta garzetta (little egret): 104126108 Help Entry 104126108         CDS       T05152                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism egz  Egretta garzetta (little egret) Pathway egz04060   Cytokine-cytokine receptor interaction egz04068   FoxO signaling pathway egz04218   Cellular senescence egz04620   Toll-like receptor signaling pathway egz04621   NOD-like receptor signaling pathway egz04623   Cytosolic DNA-sensing pathway egz04625   C-type lectin receptor signaling pathway egz04672   Intestinal immune network for IgA production egz05132   Salmonella infection egz05164   Influenza A egz05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104126108 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104126108 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104126108 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104126108 (IL6)    04621 NOD-like receptor signaling pathway     104126108 (IL6)    04623 Cytosolic DNA-sensing pathway     104126108 (IL6)    04625 C-type lectin receptor signaling pathway     104126108 (IL6)    04672 Intestinal immune network for IgA production     104126108 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104126108 (IL6)    05168 Herpes simplex virus 1 infection     104126108 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     104126108 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:egz04052]     104126108 (IL6) Cytokines and neuropeptides [BR:egz04052]  Cytokines   Interleukins    104126108 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 Motif Other DBs NCBI-GeneID:  104126108 NCBI-ProteinID:  XP_035749959 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MAKMSSSVSKSSAPACLAQFDSVHALDAPAKWARLPWLKGPPVKAGATLARSEKTAEVDP KTCAGSGWLWHGTDPRALYEHHPLTCAVRTTLPSRRFPAVSDFLAFLSFQDKCLRKISSG LYTFQTYLEYVQETFTSEKQSIKSLCYSTEHLARTIRQMVINPNEVIIPDSATQESLRAK LKSDKTWIEKITIHLILRDFTSFMEKTVRAVRYLKNTRSFSV NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggccaaaatgagttcaagcgtttccaaaagttccgcgccggcatgccttgcacagttt gactcagtccacgctctagatgctccagccaaatgggcacgcttgccctggctgaagggt ccccctgtgaaagctggggcaactcttgcccgctccgaaaaaactgcggaagttgaccca aagacctgtgccggctccggctggctttggcacggcacagacccccgcgctctgtatgag catcatccgcttacctgcgccgtacgcacaacgctgccgtcgaggcgcttcccagccgtg agtgactttctcgcctttctctcatttcaggataaatgcttgaggaaaatctccagcggg ctttacacgtttcagacatacctcgagtacgtacaggaaacttttacaagcgagaagcaa agcatcaaatcgctgtgctacagtacggagcacctggcgcgcaccataagacagatggtg ataaaccccaacgaggtgatcatcccagactcggctacccaggaatccctccgcgcaaag ctgaagtccgataagacctggatagagaaaatcaccatccacctcatcctccgagacttt acttcatttatggagaaaacagtgagggccgttcgctatttgaaaaataccaggagtttc agtgtctga

DBGET integrated database retrieval system