Egretta garzetta (little egret): 104128377 Help Entry 104128377         CDS       T05152                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism egz  Egretta garzetta (little egret) Pathway egz00670   One carbon pool by folate egz00790   Folate biosynthesis egz01100   Metabolic pathways egz01240   Biosynthesis of cofactors egz04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:egz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104128377 (DHFR)    00670 One carbon pool by folate     104128377 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104128377 (DHFR) Enzymes [BR:egz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104128377 (DHFR) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-GeneID:  104128377 NCBI-ProteinID:  XP_009639439 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTSHVEGKQNALIMGRKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILQEFESDTFFPEIDYKDY KLLTEYPGVPADIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgactagcacatcccatgtggaaggtaaacagaatgccctgataatgggtagaaaaacc tggttctccatacctgagaagaatcgtcctttaaaagacagaattaatatagtgctcagc agggagctcaaggaaaccccaaaaggagcacattatctttccaaaagtctggatgatgct ttggctcttttggattcaccagagttaaaaagcaaagtcgacatggtttggattgtcgga ggcacttcagtttacaaggcagcgatggagaagccaattaatcatcgattgtttgtgaca agaattttgcaggaatttgaaagtgacacattttttccagaaatcgactacaaagactac aaacttcttactgaatacccaggtgtccctgctgatatccaagaagagaatggcatccag tacaaatttgaagtgtatgaaaaagctgtcttggcacaataa

DBGET integrated database retrieval system