Ethanoligenens harbinense: Ethha_1040
Help
Entry
Ethha_1040 CDS
T01384
Name
(GenBank) DNA ligase, NAD-dependent
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
eha
Ethanoligenens harbinense
Pathway
eha03030
DNA replication
eha03410
Base excision repair
eha03420
Nucleotide excision repair
eha03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
eha00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
Ethha_1040
03410 Base excision repair
Ethha_1040
03420 Nucleotide excision repair
Ethha_1040
03430 Mismatch repair
Ethha_1040
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
eha03032
]
Ethha_1040
03400 DNA repair and recombination proteins [BR:
eha03400
]
Ethha_1040
Enzymes [BR:
eha01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
Ethha_1040
DNA replication proteins [BR:
eha03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
Ethha_1040
DNA repair and recombination proteins [BR:
eha03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
Ethha_1040
NER (nucleotide excision repair)
GGR (global genome repair) factors
Ethha_1040
MMR (mismatch excision repair)
DNA ligase
Ethha_1040
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
Ethha_1040
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
HHH_5
Nlig-Ia
DNA_ligase_ZBD
PTCB-BRCT
BRCT_2
HHH
Zn_ribbon_NUD
Motif
Other DBs
NCBI-ProteinID:
ADU26593
UniProt:
E6U493
LinkDB
All DBs
Position
1147871..1149856
Genome browser
AA seq
661 aa
AA seq
DB search
MDAAARAKELRKALSRHNYLYYVLDAPEIEDFEYDRMLRELEELEAAHPEIVTPDSPTQR
VGGEAVGQFEPVRHEVPMESLQDVFSVEEVRAFDERMHAALSTVRYAVEPKIDGLSVALE
YRNGLFVRGSTRGDGVTGEDVTANLRTVRSIPLRLSRPLPFLEVRGEVFMPVAKFEALVR
AQELREEKLFKNPRNAAAGSLRQKNPKITSARGLDIFVFNIQRIEGATVESHLAGHALLK
ELGFKVVAHTACDTLEKTETEITRIGESRGSLPYGIDGAVVKVDDFTARRMLGSTAKFPR
WAVAFKFPPEEKRTGLLSIDINVGRTGALTPTAVLEPVLLAGSTVARASLHNEDFIREKD
IRIGDTVVVRKAGDIIPEIVSVAEHGGGKPYRMPTACPSCGAPVAREKDEAVLRCQNPDC
PAQLLRHLIHFASRDAMDIEGMGPALVESLVGEGLVRSIADVYDLNAEAVAKLERMGKKS
AENLIAAIETSKRAGLARLLYALGVRQVGQKAAGLIAARFGSMERLFSATEDELCAIDEI
GGIIAENVVRFFALEDTARLVERLRAAGVDLTAREQEVADTRLSGQIFVLTGTLSKYSRE
EAKKRIEALGGKVTGSVSKKTSYVVAGEEAGSKLDKALALGVPVLDEAAFEQLLGISETE
E
NT seq
1986 nt
NT seq
+upstream
nt +downstream
nt
atggacgccgccgcgcgtgcaaaggaattgagaaaagcgctgtcccgccataactatctc
tattatgtgctggacgcgcccgaaatagaagattttgaatacgaccgcatgctgcgggaa
ctggaagaactggaagccgcacatccggagatcgtcacgcccgattcgcccacgcagcgg
gtgggcggcgaggctgtggggcagtttgagcccgtgcggcacgaggtgcccatggaaagc
ctgcaggatgtgttctccgtggaagaggtgcgcgcgtttgatgagcggatgcacgccgcc
ctgtccactgtgcgctatgcggtagaaccgaaaatcgacgggctttcggtcgcgcttgaa
taccgaaacggcctgttcgtgcgcggctccacccgcggcgacggcgtgaccggtgaggat
gtgaccgctaatctgcgcacggtgcgctccatcccgctgcggctttcgcgtccgctgccc
tttctggaagtgcgcggcgaggtgttcatgcccgtggcgaagtttgaggcgttggtgcgt
gcgcaggagctgcgcgaggaaaagctgtttaaaaacccgcgcaacgccgccgccggctcg
ctgcggcagaagaacccgaagatcacctctgcccgcgggctggatattttcgtgttcaat
atccagcgcatcgagggcgcgacggtggagagccacctggccgggcatgcgctgctcaaa
gagctgggctttaaggtggtggcgcacaccgcctgcgatactctcgaaaagacggagacg
gagatcacccgcatcggggagagccgcggcagcctgccgtacggcattgacggcgcggtg
gtgaaggtagacgatttcaccgcacggcgtatgcttggcagcacggccaaattcccgcgc
tgggcggtggcgttcaagtttccgccggaggaaaagcgcaccggattgctcagcatcgac
atcaacgtcgggcgcaccggcgcgctcacgcccaccgccgttctggagccggtcttgctg
gcaggaagcaccgtggctcgcgcttccctgcacaacgaggatttcatccgggagaaagac
atccgtatcggggacacggtggtggtgcgcaaggcgggggacattattccagagattgtg
tccgtggccgaacacggcgggggaaaaccctaccgtatgcccacggcctgcccgtcctgc
ggggccccggtggcgcgggagaaagacgaggccgtgctgcgctgccagaaccccgactgc
ccggcgcagctgctgcgccacctcatccactttgcctcgcgcgacgcgatggatatcgag
gggatgggcccggcgctggtggaatcgcttgtgggggaggggctggtgcgctccatcgcc
gatgtgtacgacctgaatgcggaagctgttgccaagctggaacggatgggcaaaaaatcg
gccgagaacctcattgccgctattgaaacatccaaacgggccgggctggcgcgcctgctc
tacgcgctgggcgtaaggcaggtggggcagaaggccgcgggtctcatcgccgcgcgcttc
ggcagcatggagcggttgttttccgccacggaggacgaactctgcgccatcgacgagatc
ggcggcatcatcgcggaaaacgtggtgcgtttctttgcgctggaagataccgccagactg
gtggaacgcctgcgcgccgcaggggtggacctcaccgcgcgtgagcaggaagtggcggac
acccggctttccgggcagatttttgtgctcaccggcacgctgtcgaagtattcccgcgag
gaagccaaaaagcgcattgaagcgctgggtggcaaggtgaccggcagcgtgtccaaaaag
acgagctatgtcgtcgcgggggaggaagccggttccaagctggacaaggccctggcgctg
ggtgtgccggtgctggatgaagcggcatttgagcaattattgggaatatcggaaacggag
gaataa
DBGET
integrated database retrieval system