Eurypyga helias (sunbittern): 104516250 Help Entry 104516250         CDS       T08356                                  Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ehs  Eurypyga helias (sunbittern) Pathway ehs00670   One carbon pool by folate ehs00790   Folate biosynthesis ehs01100   Metabolic pathways ehs01240   Biosynthesis of cofactors ehs04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:ehs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104516250    00670 One carbon pool by folate     104516250  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104516250 Enzymes [BR:ehs01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104516250 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  104516250 NCBI-ProteinID:  XP_010158831 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search NEYKYFQRMTSTSHVEGKQNALIMGRKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHY LSKSLDDALVLLDSPELKSKVDMVWIVGGTSVYK NT seq 283 nt NT seq  +upstreamnt  +downstreamnt gaatgagtacaagtacttccagagaatgactagcacatcccacgtggaaggtaaacagaa tgcactgataatgggaagaaaaacctggttctccattcctgagaagaatcgtcctttaaa agacagaattaatatagtgctcagcagggagctcaaggaaacaccaaaaggagcacatta tctttccaaaagcctggatgatgctttagttcttttggattcaccagaattaaaaagtaa agtagacatggtttggatcgttggaggcacttcagtttacaag

DBGET integrated database retrieval system