Emiliania huxleyi: EMIHUDRAFT_372344 Help Entry EMIHUDRAFT_372344 CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ehx  Emiliania huxleyi Pathway ehx00790   Folate biosynthesis ehx01100   Metabolic pathways ehx01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ehx00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EMIHUDRAFT_372344 Enzymes [BR:ehx01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      EMIHUDRAFT_372344  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      EMIHUDRAFT_372344  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      EMIHUDRAFT_372344 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  17252358 NCBI-ProteinID:  XP_005758637 JGI:  Emihu1_372344 UniProt:  A0A0D3KHT4 R1FPH3 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MQTDHEAAAASDHIDDTVSYVGVYDQVRSVVEGPPRALIETVAVEVAREVLSGNARVDEV TVVLRKPQVPINGILAYASVEVSRDREWLESLRRA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcagacggatcacgaggccgcagccgcgagtgaccacatcgacgacactgtgagctac gtcggcgtgtacgaccaggtgcgctccgttgtcgagggcccgccgagggcgctgatagaa acggtggcggtcgaggtcgcgcgcgaggtgctgtcgggcaacgcacgcgtggacgaggtg acggtggtcctgcgcaagccgcaggttcctatcaatggtatccttgcctacgccagcgtt gaagtgagtcgcgaccgagagtggcttgagtcgctcagacgagcctga

DBGET integrated database retrieval system