Eumetopias jubatus (Steller sea lion): 114209547 Help Entry 114209547         CDS       T07240                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04151   PI3K-Akt signaling pathway eju04630   JAK-STAT signaling pathway eju04640   Hematopoietic cell lineage eju04657   IL-17 signaling pathway eju04658   Th1 and Th2 cell differentiation eju04659   Th17 cell differentiation eju04660   T cell receptor signaling pathway eju04664   Fc epsilon RI signaling pathway eju04672   Intestinal immune network for IgA production eju05140   Leishmaniasis eju05200   Pathways in cancer eju05310   Asthma eju05320   Autoimmune thyroid disease eju05321   Inflammatory bowel disease eju05330   Allograft rejection Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114209547 (IL4)    04151 PI3K-Akt signaling pathway     114209547 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114209547 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     114209547 (IL4)    04660 T cell receptor signaling pathway     114209547 (IL4)    04658 Th1 and Th2 cell differentiation     114209547 (IL4)    04659 Th17 cell differentiation     114209547 (IL4)    04657 IL-17 signaling pathway     114209547 (IL4)    04664 Fc epsilon RI signaling pathway     114209547 (IL4)    04672 Intestinal immune network for IgA production     114209547 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114209547 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     114209547 (IL4)   09163 Immune disease    05310 Asthma     114209547 (IL4)    05320 Autoimmune thyroid disease     114209547 (IL4)    05321 Inflammatory bowel disease     114209547 (IL4)    05330 Allograft rejection     114209547 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114209547 (IL4)    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114209547 (IL4) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114209547 (IL4) Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Cytokines    114209547 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 DUF927 Motif Other DBs NCBI-GeneID:  114209547 NCBI-ProteinID:  XP_027959437 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MGLTSQLIPTLVCLLALTSTFVHGHNFSIAIKEIIRTLNILTARNDLCMELTVTDIFAAP KNTTEKEIFCRATTVLQQLSTHNCYNKLLGGLHRNLRKMANMTCSVNEVKKSTLKDFLER LKAIMQRKYYRH NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccgactctggtctgcttactagcactcaccagcacc tttgtccatggacataacttcagtattgccattaaagagatcatcagaacgttgaacatc ctcacagcgagaaacgacttgtgcatggagctgaccgtcactgacatcttcgctgcccca aagaacacaactgaaaaagaaatcttctgcagagctacaactgtgcttcagcagctctct acacacaattgctacaacaaactccttggaggacttcacaggaacctcaggaaaatggca aacatgacctgttcggtgaatgaagtcaagaagagtacactgaaagacttcttggaaagg ctaaaagcgatcatgcaaaggaaatactacaggcactga

DBGET integrated database retrieval system