Eumetopias jubatus (Steller sea lion): 114214898 Help Entry 114214898         CDS       T07240                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04010   MAPK signaling pathway eju04014   Ras signaling pathway eju04015   Rap1 signaling pathway eju04024   cAMP signaling pathway eju04062   Chemokine signaling pathway eju04510   Focal adhesion eju04520   Adherens junction eju04611   Platelet activation eju04670   Leukocyte transendothelial migration eju04720   Long-term potentiation eju04722   Neurotrophin signaling pathway eju04934   Cushing syndrome eju04972   Pancreatic secretion eju05211   Renal cell carcinoma eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114214898 (RAP1B)    04014 Ras signaling pathway     114214898 (RAP1B)    04015 Rap1 signaling pathway     114214898 (RAP1B)    04024 cAMP signaling pathway     114214898 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     114214898 (RAP1B)    04520 Adherens junction     114214898 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     114214898 (RAP1B)    04670 Leukocyte transendothelial migration     114214898 (RAP1B)    04062 Chemokine signaling pathway     114214898 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     114214898 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     114214898 (RAP1B)    04722 Neurotrophin signaling pathway     114214898 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     114214898 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114214898 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     114214898 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114214898 (RAP1B)    04031 GTP-binding proteins [BR:eju04031]     114214898 (RAP1B) Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114214898 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    114214898 (RAP1B)   Exosomal proteins of colorectal cancer cells    114214898 (RAP1B) GTP-binding proteins [BR:eju04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     114214898 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  114214898 NCBI-ProteinID:  XP_027966549 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagatttatacatgaaaaatggacagggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagacctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaacctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system