Eumetopias jubatus (Steller sea lion): 114221910 Help Entry 114221910         CDS       T07240                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04068   FoxO signaling pathway eju04148   Efferocytosis eju04625   C-type lectin receptor signaling pathway eju04630   JAK-STAT signaling pathway eju04660   T cell receptor signaling pathway eju04672   Intestinal immune network for IgA production eju05133   Pertussis eju05135   Yersinia infection eju05140   Leishmaniasis eju05142   Chagas disease eju05143   African trypanosomiasis eju05144   Malaria eju05145   Toxoplasmosis eju05146   Amoebiasis eju05150   Staphylococcus aureus infection eju05152   Tuberculosis eju05310   Asthma eju05320   Autoimmune thyroid disease eju05321   Inflammatory bowel disease eju05322   Systemic lupus erythematosus eju05330   Allograft rejection Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114221910 (IL10)    04068 FoxO signaling pathway     114221910 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114221910 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     114221910 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     114221910 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114221910 (IL10)    04660 T cell receptor signaling pathway     114221910 (IL10)    04672 Intestinal immune network for IgA production     114221910 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     114221910 (IL10)    05133 Pertussis     114221910 (IL10)    05150 Staphylococcus aureus infection     114221910 (IL10)    05152 Tuberculosis     114221910 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     114221910 (IL10)    05144 Malaria     114221910 (IL10)    05145 Toxoplasmosis     114221910 (IL10)    05140 Leishmaniasis     114221910 (IL10)    05142 Chagas disease     114221910 (IL10)    05143 African trypanosomiasis     114221910 (IL10)   09163 Immune disease    05310 Asthma     114221910 (IL10)    05322 Systemic lupus erythematosus     114221910 (IL10)    05320 Autoimmune thyroid disease     114221910 (IL10)    05321 Inflammatory bowel disease     114221910 (IL10)    05330 Allograft rejection     114221910 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114221910 (IL10)    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114221910 (IL10) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114221910 (IL10) Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Cytokines    114221910 (IL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 ALIX_LYPXL_bnd CLZ Motif Other DBs NCBI-GeneID:  114221910 NCBI-ProteinID:  XP_027975922 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MPSPSLLCCLVLLVGVGASRHQSALSEDNCTHFPASLPHMLRELRAAFGRVKTFFQMKDK LDNMLLTGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFSKLQERGVYKAMSEFDIFINYIETYMTMRMKI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagcccatcgctgctgtgttgcctggtcctcctggtcggggtaggagccagccga caccagagcgccctgtctgaggacaactgcacccacttcccagccagcctgccccacatg ctccgagagctccgagctgccttcggcagggtgaagactttttttcaaatgaaggacaag ctggacaacatgttgttgaccgggtccttgctagaggactttaagggttacctgggttgc caagccttgtcggagatgatccagttctacctggaggaggtgatgccccaggctgagaac cacgacccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctcagg ctgaggctgcggcgttgtcatcgctttctgccctgtgagaataagagcaaggcggtggag caggtgaagaatgcctttagtaagctccaagagagaggtgtctacaaagccatgagtgag tttgacatcttcatcaactacatagaaacctacatgacaatgaggatgaaaatctga

DBGET integrated database retrieval system