KEGG   Eumetopias jubatus (Steller sea lion): 114224308
Entry
114224308         CDS       T07240                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju01521  EGFR tyrosine kinase inhibitor resistance
eju01522  Endocrine resistance
eju01524  Platinum drug resistance
eju04012  ErbB signaling pathway
eju04014  Ras signaling pathway
eju04015  Rap1 signaling pathway
eju04024  cAMP signaling pathway
eju04062  Chemokine signaling pathway
eju04066  HIF-1 signaling pathway
eju04068  FoxO signaling pathway
eju04070  Phosphatidylinositol signaling system
eju04071  Sphingolipid signaling pathway
eju04072  Phospholipase D signaling pathway
eju04081  Hormone signaling
eju04140  Autophagy - animal
eju04150  mTOR signaling pathway
eju04151  PI3K-Akt signaling pathway
eju04152  AMPK signaling pathway
eju04210  Apoptosis
eju04211  Longevity regulating pathway
eju04213  Longevity regulating pathway - multiple species
eju04218  Cellular senescence
eju04360  Axon guidance
eju04370  VEGF signaling pathway
eju04380  Osteoclast differentiation
eju04510  Focal adhesion
eju04517  IgSF CAM signaling
eju04518  Integrin signaling
eju04550  Signaling pathways regulating pluripotency of stem cells
eju04611  Platelet activation
eju04613  Neutrophil extracellular trap formation
eju04620  Toll-like receptor signaling pathway
eju04625  C-type lectin receptor signaling pathway
eju04630  JAK-STAT signaling pathway
eju04650  Natural killer cell mediated cytotoxicity
eju04660  T cell receptor signaling pathway
eju04662  B cell receptor signaling pathway
eju04664  Fc epsilon RI signaling pathway
eju04666  Fc gamma R-mediated phagocytosis
eju04668  TNF signaling pathway
eju04670  Leukocyte transendothelial migration
eju04722  Neurotrophin signaling pathway
eju04725  Cholinergic synapse
eju04750  Inflammatory mediator regulation of TRP channels
eju04810  Regulation of actin cytoskeleton
eju04910  Insulin signaling pathway
eju04914  Progesterone-mediated oocyte maturation
eju04915  Estrogen signaling pathway
eju04917  Prolactin signaling pathway
eju04919  Thyroid hormone signaling pathway
eju04923  Regulation of lipolysis in adipocytes
eju04926  Relaxin signaling pathway
eju04929  GnRH secretion
eju04930  Type II diabetes mellitus
eju04931  Insulin resistance
eju04932  Non-alcoholic fatty liver disease
eju04933  AGE-RAGE signaling pathway in diabetic complications
eju04935  Growth hormone synthesis, secretion and action
eju04960  Aldosterone-regulated sodium reabsorption
eju04973  Carbohydrate digestion and absorption
eju05010  Alzheimer disease
eju05017  Spinocerebellar ataxia
eju05020  Prion disease
eju05100  Bacterial invasion of epithelial cells
eju05135  Yersinia infection
eju05142  Chagas disease
eju05146  Amoebiasis
eju05160  Hepatitis C
eju05161  Hepatitis B
eju05162  Measles
eju05163  Human cytomegalovirus infection
eju05164  Influenza A
eju05165  Human papillomavirus infection
eju05166  Human T-cell leukemia virus 1 infection
eju05167  Kaposi sarcoma-associated herpesvirus infection
eju05168  Herpes simplex virus 1 infection
eju05169  Epstein-Barr virus infection
eju05170  Human immunodeficiency virus 1 infection
eju05171  Coronavirus disease - COVID-19
eju05200  Pathways in cancer
eju05203  Viral carcinogenesis
eju05205  Proteoglycans in cancer
eju05206  MicroRNAs in cancer
eju05207  Chemical carcinogenesis - receptor activation
eju05208  Chemical carcinogenesis - reactive oxygen species
eju05210  Colorectal cancer
eju05211  Renal cell carcinoma
eju05212  Pancreatic cancer
eju05213  Endometrial cancer
eju05214  Glioma
eju05215  Prostate cancer
eju05218  Melanoma
eju05220  Chronic myeloid leukemia
eju05221  Acute myeloid leukemia
eju05222  Small cell lung cancer
eju05223  Non-small cell lung cancer
eju05224  Breast cancer
eju05225  Hepatocellular carcinoma
eju05226  Gastric cancer
eju05230  Central carbon metabolism in cancer
eju05231  Choline metabolism in cancer
eju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eju05415  Diabetic cardiomyopathy
eju05417  Lipid and atherosclerosis
eju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114224308
   04014 Ras signaling pathway
    114224308
   04015 Rap1 signaling pathway
    114224308
   04370 VEGF signaling pathway
    114224308
   04630 JAK-STAT signaling pathway
    114224308
   04668 TNF signaling pathway
    114224308
   04066 HIF-1 signaling pathway
    114224308
   04068 FoxO signaling pathway
    114224308
   04070 Phosphatidylinositol signaling system
    114224308
   04072 Phospholipase D signaling pathway
    114224308
   04071 Sphingolipid signaling pathway
    114224308
   04024 cAMP signaling pathway
    114224308
   04151 PI3K-Akt signaling pathway
    114224308
   04152 AMPK signaling pathway
    114224308
   04150 mTOR signaling pathway
    114224308
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    114224308
   04517 IgSF CAM signaling
    114224308
   04518 Integrin signaling
    114224308
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114224308
  09143 Cell growth and death
   04210 Apoptosis
    114224308
   04218 Cellular senescence
    114224308
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114224308
   04550 Signaling pathways regulating pluripotency of stem cells
    114224308
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114224308
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    114224308
   04613 Neutrophil extracellular trap formation
    114224308
   04620 Toll-like receptor signaling pathway
    114224308
   04625 C-type lectin receptor signaling pathway
    114224308
   04650 Natural killer cell mediated cytotoxicity
    114224308
   04660 T cell receptor signaling pathway
    114224308
   04662 B cell receptor signaling pathway
    114224308
   04664 Fc epsilon RI signaling pathway
    114224308
   04666 Fc gamma R-mediated phagocytosis
    114224308
   04670 Leukocyte transendothelial migration
    114224308
   04062 Chemokine signaling pathway
    114224308
  09152 Endocrine system
   04910 Insulin signaling pathway
    114224308
   04923 Regulation of lipolysis in adipocytes
    114224308
   04929 GnRH secretion
    114224308
   04915 Estrogen signaling pathway
    114224308
   04914 Progesterone-mediated oocyte maturation
    114224308
   04917 Prolactin signaling pathway
    114224308
   04926 Relaxin signaling pathway
    114224308
   04935 Growth hormone synthesis, secretion and action
    114224308
   04919 Thyroid hormone signaling pathway
    114224308
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    114224308
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114224308
  09156 Nervous system
   04725 Cholinergic synapse
    114224308
   04722 Neurotrophin signaling pathway
    114224308
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    114224308
  09158 Development and regeneration
   04360 Axon guidance
    114224308
   04380 Osteoclast differentiation
    114224308
  09149 Aging
   04211 Longevity regulating pathway
    114224308
   04213 Longevity regulating pathway - multiple species
    114224308
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114224308
   05206 MicroRNAs in cancer
    114224308
   05205 Proteoglycans in cancer
    114224308
   05207 Chemical carcinogenesis - receptor activation
    114224308
   05208 Chemical carcinogenesis - reactive oxygen species
    114224308
   05203 Viral carcinogenesis
    114224308
   05230 Central carbon metabolism in cancer
    114224308
   05231 Choline metabolism in cancer
    114224308
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114224308
  09162 Cancer: specific types
   05210 Colorectal cancer
    114224308
   05212 Pancreatic cancer
    114224308
   05225 Hepatocellular carcinoma
    114224308
   05226 Gastric cancer
    114224308
   05214 Glioma
    114224308
   05221 Acute myeloid leukemia
    114224308
   05220 Chronic myeloid leukemia
    114224308
   05218 Melanoma
    114224308
   05211 Renal cell carcinoma
    114224308
   05215 Prostate cancer
    114224308
   05213 Endometrial cancer
    114224308
   05224 Breast cancer
    114224308
   05222 Small cell lung cancer
    114224308
   05223 Non-small cell lung cancer
    114224308
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114224308
   05170 Human immunodeficiency virus 1 infection
    114224308
   05161 Hepatitis B
    114224308
   05160 Hepatitis C
    114224308
   05171 Coronavirus disease - COVID-19
    114224308
   05164 Influenza A
    114224308
   05162 Measles
    114224308
   05168 Herpes simplex virus 1 infection
    114224308
   05163 Human cytomegalovirus infection
    114224308
   05167 Kaposi sarcoma-associated herpesvirus infection
    114224308
   05169 Epstein-Barr virus infection
    114224308
   05165 Human papillomavirus infection
    114224308
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    114224308
   05100 Bacterial invasion of epithelial cells
    114224308
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114224308
   05142 Chagas disease
    114224308
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114224308
   05017 Spinocerebellar ataxia
    114224308
   05020 Prion disease
    114224308
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114224308
   05418 Fluid shear stress and atherosclerosis
    114224308
   05415 Diabetic cardiomyopathy
    114224308
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    114224308
   04932 Non-alcoholic fatty liver disease
    114224308
   04931 Insulin resistance
    114224308
   04933 AGE-RAGE signaling pathway in diabetic complications
    114224308
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114224308
   01524 Platinum drug resistance
    114224308
   01522 Endocrine resistance
    114224308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eju04131]
    114224308
Membrane trafficking [BR:eju04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    114224308
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 Transcrip_act Exonuc_VII_L
Other DBs
NCBI-GeneID: 114224308
NCBI-ProteinID: XP_027979260
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gatatgccagatggtacgttcttggtcagagatgcctcaacaaaaatgcagggggattac
actttgactttgcggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctaatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagacaacattgatgcagttggtaaaaaa
ctgcaagagtaccactctcagtatcaggaaaagagtaaagagtatgacaggctatatgag
gaatataccagaacgtcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcggtttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattt
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgacggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctccctgaaggagctggtgctccattaccagcagacctccctcgttcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcactctgc
agataa

DBGET integrated database retrieval system