KEGG   Elioraea tepida: KO353_04955
Entry
KO353_04955       CDS       T07340                                 
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
elio  Elioraea tepida
Pathway
elio03030  DNA replication
elio03410  Base excision repair
elio03420  Nucleotide excision repair
elio03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:elio00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    KO353_04955 (ligA)
   03410 Base excision repair
    KO353_04955 (ligA)
   03420 Nucleotide excision repair
    KO353_04955 (ligA)
   03430 Mismatch repair
    KO353_04955 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elio03032]
    KO353_04955 (ligA)
   03400 DNA repair and recombination proteins [BR:elio03400]
    KO353_04955 (ligA)
Enzymes [BR:elio01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     KO353_04955 (ligA)
DNA replication proteins [BR:elio03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     KO353_04955 (ligA)
DNA repair and recombination proteins [BR:elio03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     KO353_04955 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     KO353_04955 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     KO353_04955 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KO353_04955 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB BRCT HHH_2 DNA_ligase_ZBD HHH_5 PTCB-BRCT GT4-conflict Nlig-Ia Bep_C_terminal DZR_2
Other DBs
NCBI-ProteinID: QXM25564
UniProt: A0A975U4U4
LinkDB
Position
1026535..1028619
AA seq 694 aa
MTGGLRARPPEALTETEAAEELAALAAEIARHDRLYFQRDRPEISDAEYDALKRRNDAIE
ARFPHLVRPDSPSRRVGAAPVRGFAKARHRQPMLSLDNAFDREDFAAFVSRIRNFLGLDP
GIRLAFVAEPKIDGASINLTYERGVFVRGATRGDGTEGEDVTANLLTVADLPRRLSGDAP
ALIEIRGEVYMEKAEFLALNARLESEGEEPFMNPRNAAAGSLRQKDPSVTATRPLRLFAY
AMGEASERVADTHHGFLERLRLWGMPVNPLSALLEDWQEAEAFQERIGAQRSALPYDIDG
VVYKLDRLDWQERLGVVGRAPRWAIAWKFPAERATTVLRDIEIQVGRTGALTPRAVMDPV
TVGGVVVRHATLHNEDEIARKDIRIGDTVIVQRAGDVIPQVVGVVLEKRPAGAAPYVFPD
RCPACGSHAVRAEGEAVRRCTGGLICPAQVVERLRHFASRGAVDIEGLGEENIILFHDAG
LIREPADIYRLHRHREVILSWKGWKERKLDNLLRAIEARRRIPLERLIFALGIRRVGEAT
ARLLARHYGSFRAWREAMLAARVAGSEARQELGTIVGIGPAIAEELVEFFAEPRNLKALD
ALMAEVTAEDATVPEAAASPLAGKTVVFTGTLETMTRQEAKARAEALGAKVTDSVSKKTD
LVVVGADAGSKAEKAAALGVRTLTEAEWRALIGL
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgacaggggggttgcgcgcgcgcccgccggaggcgctgaccgagacggaagcggcggag
gagcttgccgcgctcgccgccgagatcgcccggcacgataggctctacttccagcgcgac
cggcccgagatctcggatgccgaatatgacgcgctgaagcgacggaacgacgcgatcgag
gcgcggtttccccatctcgtccggcccgacagcccctcgcgccgggtcggcgccgccccg
gtgcgcggcttcgccaaggcgcggcatcgccagccgatgctctcgctcgacaacgccttc
gatcgggaggatttcgccgctttcgtttcgcgcatccgcaatttcctcggcctcgacccg
ggcatccgcctcgccttcgtcgccgagccgaagattgacggcgcctcgatcaacctgacc
tacgagcggggcgtgttcgtccgcggcgccacgcgcggcgacggcacggaaggcgaggac
gtgaccgccaacctgctcaccgtcgctgacctgccgcgccggctctcgggcgacgccccg
gcgctgatcgagattcgcggcgaggtctacatggagaaggccgagttcctcgcgctcaac
gcgcggctcgagagcgagggcgaggagccgttcatgaacccgcgcaacgccgctgccgga
tcgttgcgccagaaggacccgtccgtcaccgcaacgcggccgctgcgcctgttcgcctat
gcgatgggcgaggcctcggagcgcgtcgccgacacccaccacggcttcctcgagcgcctg
cgcctctggggcatgccggtgaacccgctctccgccctgctcgaggactggcaggaggcg
gaagcgttccaggaacgaatcggcgcccagcgctccgccctgccctacgacatcgacggt
gtggtctacaagctcgatcggcttgattggcaggagcggctcggcgtcgtcggccgcgcg
ccgcgctgggcgatcgcgtggaagttcccggccgagcgggcaacgaccgtgctgcgcgac
atcgagatccaggtcggccgcaccggggcgctgacgccgcgcgcggtgatggacccggtc
accgtcggcggcgtcgtcgtccgccacgccacgctgcacaacgaggacgagatcgcgcgc
aaggacatccgaatcggcgatacggtgatcgtccagcgcgccggagacgtgatcccgcag
gtggtcggcgtggtgctggagaagcggccggccggcgcggctccttacgtgttccccgac
cgctgcccggcctgcggcagccacgcggttcgcgccgagggagaggcggtgcgtcgttgc
accggcgggctgatctgccccgcccaggtggtggagcggctgcgccatttcgcctcgcgc
ggcgcggtcgacatcgaaggcctcggcgaggagaacatcatcctgttccacgacgcgggc
ctgatccgcgaaccggccgacatctaccgcctccatcgccaccgcgaggtgatcctctcc
tggaaaggctggaaggagcgcaagctcgacaacctcctcagggcgatcgaggcgcggcgg
cgcatcccgctcgagcggctgatcttcgccttggggatacgccgcgtcggcgaggcaacg
gcgcggctgcttgcccgccactacggaagcttccgcgcctggcgcgaggcgatgctcgcg
gcgcgtgtcgccggctccgaagcccgccaggagctcggcaccattgtcggcatcggcccc
gcgatcgccgaggagctcgtcgagttcttcgccgaaccgcgcaacctcaaggcgctcgat
gcgctgatggcggaggtgacggccgaggacgcgaccgtgccggaggcggcagcgagcccg
ctcgccggcaagacagtggtgttcaccggaacgctcgagacgatgacgcgccaagaggcg
aaggcgcgcgccgaggcgctcggcgcgaaggtgaccgacagcgtctcgaaaaagaccgat
ctcgttgtggtcggcgcggacgccggctcgaaggcggagaaggcggcggcgctcggggtg
cgcaccctcaccgaggcggagtggcgggcgctcattgggctttga

DBGET integrated database retrieval system