Esox lucius (northern pike): 105012114 Help Entry 105012114         CDS       T04894                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism els  Esox lucius (northern pike) Pathway els04060   Cytokine-cytokine receptor interaction els04672   Intestinal immune network for IgA production els04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105012114  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105012114  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     105012114  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:els04052]     105012114    00536 Glycosaminoglycan binding proteins [BR:els00536]     105012114 Cytokines and neuropeptides [BR:els04052]  Cytokines   Chemokines    105012114 Glycosaminoglycan binding proteins [BR:els00536]  Heparan sulfate / Heparin   Chemokines    105012114 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105012114 NCBI-ProteinID:  XP_010871051 UniProt:  A0AAY5LDL9 LinkDB All DBs Position LG09:complement(10747622..10754848) Genome browser AA seq 103 aa AA seqDB search MKTTMDVKVLTVLTLLSVAMDVPLSTAKPISLVERCWCRSTLNTVPQRSIRELKFLHTPN CPFQVIAKLKNNREVCINPETKWLQTYLKNAINKVKKSRRRAQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaagaccaccatggatgtcaaagtgctgactgtattgaccctgctgtccgttgccatg gatgtgcccctctctacagccaagcccattagcctggtggagaggtgctggtgtcgctca accctgaacaccgtcccgcagaggagcatcagggagctcaagttcctccacacgcccaac tgccccttccaagtcattgccaagctgaagaacaacagggaggtgtgcatcaacccagag accaaatggctgcagacctatctgaaaaatgccattaacaaggtaaagaagtcccgaagg cgtgctcagtaa

DBGET integrated database retrieval system