Esox lucius (northern pike): 105017798 Help Entry 105017798         CDS       T04894                                  Symbol rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism els  Esox lucius (northern pike) Pathway els04010   MAPK signaling pathway els04510   Focal adhesion els04517   IgSF CAM signaling els04520   Adherens junction Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105017798 (rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105017798 (rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     105017798 (rap1b)    04520 Adherens junction     105017798 (rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105017798 (rap1b)    04031 GTP-binding proteins [BR:els04031]     105017798 (rap1b) Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105017798 (rap1b)   Exosomal proteins of other body fluids (saliva and urine)    105017798 (rap1b)   Exosomal proteins of colorectal cancer cells    105017798 (rap1b) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     105017798 (rap1b) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  105017798 NCBI-ProteinID:  NP_001297935 UniProt:  A0A3P8Y9G2 C1BZ64 LinkDB All DBs Position LG18:6341145..6395810 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWSSCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSN CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagttagtagtccttggctctggaggtgtgggcaaatctgctctgact gtgcagttcgttcaggggatcttcgtggagaaatatgaccctacaatagaagactcgtac agaaagcaagtggaggtggatggacagcaatgtatgctggagattttggacaccgcggga acggaacaattcacagccatgcgtgatctgtacatgaagaacggacagggctttgcgttg gtctactctattacagcccagtccacgttcaacgacctgcaggacctacgggaacagatt ctcagggttaaagacaccgacgacgtccccatgatcctggttggtaataaatgcgacctg gaggacgagcgtgttgtggggaaggagcagggtcagaacctggcccgacagtggagcagc tgtgctttcctggagtcctccgccaagtccaagattaacgtcaacgagatcttctatgac ctggtccggcaaattaacaggaaaaccccagtacccgggaaggcacgcaaaaagtccaac tgtcaattgctctaa

DBGET integrated database retrieval system