Esox lucius (northern pike): 105025789 Help Entry 105025789         CDS       T04894                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism els  Esox lucius (northern pike) Pathway els03420   Nucleotide excision repair els04110   Cell cycle els04114   Oocyte meiosis els04120   Ubiquitin mediated proteolysis els04141   Protein processing in endoplasmic reticulum els04310   Wnt signaling pathway els04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:els00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105025789 (rbx1)    04120 Ubiquitin mediated proteolysis     105025789 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     105025789 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105025789 (rbx1)    04350 TGF-beta signaling pathway     105025789 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     105025789 (rbx1)    04114 Oocyte meiosis     105025789 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:els04121]     105025789 (rbx1)    03400 DNA repair and recombination proteins [BR:els03400]     105025789 (rbx1) Enzymes [BR:els01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105025789 (rbx1) Ubiquitin system [BR:els04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105025789 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      105025789 (rbx1)    Cul2 complex      105025789 (rbx1)    Cul3 complex      105025789 (rbx1)    Cul4 complex      105025789 (rbx1)    Cul7 complex      105025789 (rbx1)    Cul8 complex      105025789 (rbx1)    Cul9 complex      105025789 (rbx1) DNA repair and recombination proteins [BR:els03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105025789 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       105025789 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 Motif Other DBs NCBI-GeneID:  105025789 NCBI-ProteinID:  NP_001291177 UniProt:  C1BW21 LinkDB All DBs Position LG11:6885556..6887977 Genome browser AA seq 135 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECPANQ ASATSEECTVAWGVCNVWTLGARIWTTIWASVSGILLLSPPLYGGLHFESPKDATHFTQT VAECGVWCIPKRHPH NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcggcagctatggatgttgatacgccaagcggaacaaatagtggcgcaagcaagaaa cgtttcgaagtgaagaagtggaatgccgtggcactttgggcctgggacattgttgtagac aactgtgctatatgtaggaatcacattatggatctctgcatagagtgcccggccaaccaa gcctccgccacatcagaggagtgtaccgttgcctggggagtctgtaatgtatggacacta ggagcaagaatctggaccactatttgggcttctgtttcaggcatattgttgctttctcct cctttgtatggtggactccactttgagtccccaaaagacgctacacatttcacacaaacg gtggctgagtgtggtgtatggtgcattccaaagcgtcacccacattag

DBGET integrated database retrieval system