Esox lucius (northern pike): 105027239 Help Entry 105027239         CDS       T04894                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism els  Esox lucius (northern pike) Pathway els04060   Cytokine-cytokine receptor interaction els04672   Intestinal immune network for IgA production els04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105027239  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105027239  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     105027239  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:els04052]     105027239    00536 Glycosaminoglycan binding proteins [BR:els00536]     105027239 Cytokines and neuropeptides [BR:els04052]  Cytokines   Chemokines    105027239 Glycosaminoglycan binding proteins [BR:els00536]  Heparan sulfate / Heparin   Chemokines    105027239 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105027239 NCBI-ProteinID:  XP_010897535 UniProt:  A0AAY5LD63 LinkDB All DBs Position LG06:19683977..19694027 Genome browser AA seq 98 aa AA seqDB search MDLKLLAVMAVLAVATYTPVSQAKPISLVERCWCRSTVNTVSQRNIRELKFLHTPNCPFQ VIAKLKNQKEVCINPETKWLQQYLKNALNKLKRSKHIK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggatttgaaactcttggcggtaatggctgtgctcgcggtggcgacgtacactcctgtc tcacaagctaagcccatcagtctggttgagaggtgttggtgtcgttctacagtgaacacc gtctcccagcgcaacatccgagaactgaaatttctacacacacctaactgcccattccaa gtgattgccaaactgaagaatcagaaggaggtgtgtatcaaccctgagaccaagtggctg cagcagtacctgaagaacgccctcaacaagttgaagaggtccaagcatattaaatag

DBGET integrated database retrieval system