KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3605
Entry
CDCO157_3605      CDS       T02122                                 
Name
(GenBank) hypothetical protein
  KO
K23654  T3SS secreted effector NleE
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:elx00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_3605
SSDB
Motif
Pfam: NleE
Other DBs
NCBI-ProteinID: AFJ30661
LinkDB
Position
3792011..3792685
AA seq 224 aa
MINPVTNTQGVSPINTKYAEHVVKNIYPEIKHDYFNESPNIYDKKYISGITRGVAELKQE
EFVNEKARRFSYMKTMYSVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNP
DLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNY
ELPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKLSKIE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgattaatcctgttactaatactcagggcgtgtcccctataaatactaaatatgctgaa
catgtggtgaaaaatatttacccggaaattaaacatgattactttaatgaatcacccaat
atatatgataagaagtatatatccggtataaccagaggagtagctgaactaaaacaggaa
gaatttgttaacgagaaagccagacggttttcttatatgaagactatgtattctgtatgt
ccagaagcgtttgaacctatttccagaaatgaagccagtacaccggaaggaagctggcta
acagttatatccggaaaacgcccaatggggcagttttctgtagatagtttatacaatcct
gatttacatgcattatgtgagcttccggacatttgttgtaagatcttccctaaagaaaat
aatgattttttatacatagttgttgtgtacagaaatgacagccctctaggagaacaacgg
gcaaatagatttatagaattatataatataaaaagagatatcatgcaggaattaaattat
gagttaccagagttaaaggcagtaaaatctgaaatgattatcgcacgtgaaatgggagaa
atctttagctacatgcctggggaaatagacagttatatgaaatacataaataataaactt
tctaaaattgagtag

DBGET integrated database retrieval system