Epinephelus lanceolatus (giant grouper): 117268068 Help Entry 117268068         CDS       T07331                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely03420   Nucleotide excision repair ely04110   Cell cycle ely04114   Oocyte meiosis ely04120   Ubiquitin mediated proteolysis ely04141   Protein processing in endoplasmic reticulum ely04310   Wnt signaling pathway ely04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ely00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117268068 (rbx1)    04120 Ubiquitin mediated proteolysis     117268068 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     117268068 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117268068 (rbx1)    04350 TGF-beta signaling pathway     117268068 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     117268068 (rbx1)    04114 Oocyte meiosis     117268068 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ely04121]     117268068 (rbx1)    03400 DNA repair and recombination proteins [BR:ely03400]     117268068 (rbx1) Enzymes [BR:ely01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117268068 (rbx1) Ubiquitin system [BR:ely04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117268068 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      117268068 (rbx1)    Cul2 complex      117268068 (rbx1)    Cul3 complex      117268068 (rbx1)    Cul4 complex      117268068 (rbx1)    Cul7 complex      117268068 (rbx1)    Cul8 complex      117268068 (rbx1)    Cul9 complex      117268068 (rbx1) DNA repair and recombination proteins [BR:ely03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117268068 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       117268068 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  117268068 NCBI-ProteinID:  XP_033500120 LinkDB All DBs Position 16:34981888..34985004 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtagatacgccaagcggcacaaacagtggagctagcaagaag cgatttgaagtaaagaagtggaatgctgtggcgctgtgggcgtgggacattgtggtggat aactgtgcgatctgtaggaaccacattatggatctctgtatagagtgccaggccaaccaa gcttctgcaacctccgaggagtgcactgtagcctggggtgtctgcaatcatgccttccat ttccactgtatttcccgctggctgaaaacgcgacaggtgtgccctctggacaacagggag tgggagtttcagaaatacggacactag

DBGET integrated database retrieval system