Eublepharis macularius (Leopard gecko): 129335725 Help Entry 129335725         CDS       T09084                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc03420   Nucleotide excision repair emc04110   Cell cycle emc04114   Oocyte meiosis emc04120   Ubiquitin mediated proteolysis emc04141   Protein processing in endoplasmic reticulum emc04310   Wnt signaling pathway emc04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:emc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129335725 (RBX1)    04120 Ubiquitin mediated proteolysis     129335725 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     129335725 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     129335725 (RBX1)    04350 TGF-beta signaling pathway     129335725 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     129335725 (RBX1)    04114 Oocyte meiosis     129335725 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:emc04121]     129335725 (RBX1)    03400 DNA repair and recombination proteins [BR:emc03400]     129335725 (RBX1) Enzymes [BR:emc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      129335725 (RBX1) Ubiquitin system [BR:emc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    129335725 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      129335725 (RBX1)    Cul2 complex      129335725 (RBX1)    Cul3 complex      129335725 (RBX1)    Cul4 complex      129335725 (RBX1)    Cul7 complex      129335725 (RBX1)    Cul8 complex      129335725 (RBX1)    Cul9 complex      129335725 (RBX1) DNA repair and recombination proteins [BR:emc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       129335725 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       129335725 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  129335725 NCBI-ProteinID:  XP_054844492 UniProt:  A0AA97JUU7 LinkDB All DBs Position 9:39615885..39623310 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDAPSGANSSAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgctgcgatggatgtggatgctcctagcggggctaatagtagtgctggcaagaag cggtttgaagtgaagaagtggaatgcagtagctctctgggcttgggacatcgtggttgac aactgtgccatctgcagaaaccacattatggatctgtgcatagaatgtcaagctaaccaa gcatcagctacctctgaagaatgcactgttgcatggggcgtttgtaatcatgctttccac tttcactgcatctctcgttggcttaaaactcggcaggtgtgcccgttagacaaccgagaa tgggagttccagaagtatggacattag

DBGET integrated database retrieval system