Enterobacter sp. R4-368: H650_19080 Help Entry H650_19080        CDS       T02700                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism enr  Enterobacter sp. R4-368 Pathway enr00670   One carbon pool by folate enr00790   Folate biosynthesis enr01100   Metabolic pathways enr01240   Biosynthesis of cofactors enr04981   Folate transport and metabolism Module enr_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:enr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     H650_19080 (folA)    00670 One carbon pool by folate     H650_19080 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     H650_19080 (folA) Enzymes [BR:enr01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      H650_19080 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AGN87139 LinkDB All DBs Position 3831261..3831740 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI VISSQPGTDDRVQWVKSVDEAIAQCDGAEEIMVIGGGRVYEQFLPKAQRLYLTHIDAEVE GDTHFPDYDPDDWDSVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgcggcgttggcagtggatcgcgtcatcggcatggagaatgcgatg ccgtggaacttacctgccgatctcgcctggtttaaacgcaatacgttaaacaaaccggta gtgatgggtcgcctgacgtgggaatccatcggtcgtccgctgccgggtcgtaagaatatc gtgatcagtagccagccgggcactgatgatcgcgtgcagtgggtgaagtccgttgatgaa gcgattgcacaatgcgatggtgctgaagagatcatggtgattggcggtggtcgtgtttac gagcagtttctgccgaaagcgcagcgtttgtacctgacacacattgatgcggaagtggaa ggtgatacccatttcccggattacgatccggacgactgggattccgtgttcagtgagttc cacgacgcggacgcgcagaattctcacagttactgtttcgagatccttgagcgccgttaa

DBGET integrated database retrieval system