Enterobacter sp. DSM 30060: HWQ15_11885 Help Entry HWQ15_11885       CDS       T07983                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ens  Enterobacter sp. DSM 30060 Pathway ens00670   One carbon pool by folate ens00790   Folate biosynthesis ens01100   Metabolic pathways ens01240   Biosynthesis of cofactors ens04981   Folate transport and metabolism Module ens_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ens00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HWQ15_11885 (folA)    00670 One carbon pool by folate     HWQ15_11885 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     HWQ15_11885 (folA) Enzymes [BR:ens01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      HWQ15_11885 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 DUF7466 Motif Other DBs NCBI-ProteinID:  QLA02730 LinkDB All DBs Position 2490918..2491397 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRTTLNKPVVMGRLTWESIGRPLPGRKNI VISSQPGTDDRVQWVKSVDEAIAACGDAEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgcagcgctggcggtagaccgcgttatcggcatggaaaacgccatg ccgtggaacctgcctgccgatctcgcatggtttaaacgtactacgttaaacaagccggta gtgatgggccgcctgacctgggagtcgattggtcgtccattgccgggtcgtaagaatatt gtgatcagtagccagccgggcactgacgatcgcgtgcagtgggtgaaatccgttgatgaa gcgattgccgcctgcggcgatgccgaagagatcatggtgatcggtggtggtcgcgtgtat gagcagttcctgccaaaagcgcagaaactgtatctgacgcacattgatgcggaagtggaa ggggatacccattttccggattacgatccggacgagtgggagtccgtattcagtgagttt cacgatgcggatgcgcagaactcgcacagctactgcttcgaaattctggaacgtcgttaa

DBGET integrated database retrieval system